KEGG   Thiomonas arsenitoxydans: THI_3242Help
Entry
THI_3242          CDS       T02347                                 

Definition
putative Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     THI_3242
Secretion system [BR:thi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   THI_3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3159270..3160007
Genome map
AA seq 245 aa AA seqDB search
MNSLLSRSVARVLRGVALSAAFLSLPVMAQTLAETRAALEKAMPGLPASAKIIKTPYAGL
YEVDVGSKIFYTDAKATFLFAGEIFDTKTQTNVTKARIDDLRRVNWKDLPFKDSFKLVFG
NGKRQIAIFEDPYCPYCHKMEATLEKMSNVTLHVFVVPIIRRESMQQARDIWCAPNRSKA
WLDWMNKQVQPPAAAATCVDPLKANVELAEKLGISSTPTLIFTDGDRMEGALPQEEVEKK
LAAVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttgctctcccgctccgtcgcgcgcgttctgcgcggggtcgcgttgtccgcg
gccttcctgtctctgccggtcatggcgcaaaccctggccgaaacccgcgccgcactcgaa
aaggccatgccgggtctgcctgccagcgccaagatcatcaaaaccccctatgccgggctg
tatgaagtggacgtgggcagcaagattttttacaccgacgccaaggccacctttttgttc
gctggcgagattttcgacaccaagacccagaccaacgtcaccaaggcccggatcgacgat
ctgcgccgggtgaactggaaggatctgccgttcaaagactcgttcaagctggtgttcggt
aacggcaagcgccagatcgcgatttttgaagacccgtattgcccgtactgccacaagatg
gaagccacgctggaaaagatgagcaacgtcacgctgcatgtgttcgtcgtgcccatcatc
cgccgcgaatcgatgcaacaggcgcgcgacatctggtgcgcccccaaccgcagcaaggcc
tggctggactggatgaacaagcaagtgcagccgcccgcggccgcggcgacttgcgtcgat
ccgctcaaggccaatgtggaactcgcggagaagctgggcatttcgtccacccccacgctg
atcttcaccgacggcgaccgcatggaaggcgccctgccgcaagaggaagtcgaaaagaag
ctggccgcagtcaagtaa

DBGET integrated database retrieval system