KEGG   Thiomonas arsenitoxydans: THI_3247Help
Entry
THI_3247          CDS       T02347                                 

Definition
putative Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     THI_3247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3162557..3164029)
Genome map
AA seq 490 aa AA seqDB search
MSVTSSTPAVASSAAVQAPASKPRRSHWTRRLAIALVVALAGGGGALAWGMHEQPSIPPV
VWLQHPVQSFTFALGGNPHPVQLALPPLQPLSAVAQLGRQLFFDTALSASGKQSCASCHD
PAYGYNPPPGSGPVMLGGPNMTTPGFRPPPSLAYLYRQQPFSIGPDNEENETITLQQLAA
LGQTSQRAQKTAQSTAQSVQNLVPTGGLFWDGRVNTLQQQAGGPLFNPVEMDAGTPQRVA
AIIERQPYAKMFLQLFGPNVFADPKQTVSEALFAIARYQIEDPQFHAFNSKYDAWLQGRA
TLTSQEMRGYLAFNDVNKGDCAACHLDQPTKDHLPPLFTDTQYEALGVPRNPQIPANQNP
HYFDIGLCGPFRTDLKNQTAYCGMFLTPTLRNVAQRPVYFHNGVYHSLKQVLDFYNFRDV
QPGRIYPTVDGQVRKYDDLLPQYRANVDVTDPPLNRKLGEQPAMTAQDMRDIIAFLHTLN
DGYTPLKPTS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcacctcatccacccctgccgtcgcttcttcggctgctgtgcaggcgcctgcg
agcaagccgcgccgctcgcactggacacgccgcctggccattgcgctggtcgttgccctt
gcggggggcggcggcgcgctggcctggggcatgcacgagcagccgagcattccccccgtc
gtttggctgcagcatccggtgcagagcttcactttcgcgctaggcggcaatccgcatccg
gtgcagctcgcgctgccgcccctgcaacccctctcggccgtggcgcaactggggcgtcag
ttgttttttgatacggcgctttcagcctcgggcaagcagtcttgcgcgtcttgtcatgat
ccggcctatggctacaacccgccgccgggcagtgggccggtgatgctgggcgggccgaat
atgactacacccggctttcgcccgccgccgtcgctggcctacctctaccggcagcagccg
ttctccatcggcccggacaacgaggagaacgaaaccatcaccctgcagcaactcgcggcg
ctggggcagaccagccagcgggcgcagaagaccgcgcagagcacggcgcagtcggtacaa
aatctggtgcccaccggcgggctgttctgggacgggcgggtcaataccctgcagcagcag
gcgggtggcccgctgttcaacccggtggaaatggacgcgggcacgccgcagcgcgtggcc
gccatcatcgagcgccagccgtatgccaagatgtttttgcaactcttcggccccaatgtg
tttgcagacccgaagcagacggtttccgaggcgttgtttgcgatcgcccgttaccagatc
gaagacccgcagttccacgccttcaacagcaagtacgacgcctggctgcagggcagggcg
actctgacgtcgcaggaaatgcgcggctatctggcgttcaacgatgtgaacaagggcgat
tgcgctgcctgccatttggatcagccgaccaaggatcatctgccgccgctgttcaccgac
acgcagtacgaggcgctgggcgtgccgcgtaatccacagattccggcgaaccagaacccg
cactacttcgatatcgggctgtgcggccccttccggaccgacctgaaaaaccagactgcc
tactgcggcatgttcctcactcccacgctgcgcaatgtggcgcagcggccggtgtatttc
cataacggggtctatcactcgctcaagcaggtgctcgatttctacaacttccgcgacgtg
cagccgggcagaatctaccccaccgtggacggccaggtgcgcaagtacgacgacctgctg
ccgcagtaccgcgccaatgtggacgtgaccgatccgccgctcaaccgcaaactgggcgaa
cagcccgcgatgaccgcgcaggacatgcgcgacatcatcgctttcctgcacaccctgaac
gacggctacacgccgctcaagccgacttcataa

DBGET integrated database retrieval system