KEGG   Thiomonas arsenitoxydans: THI_3344Help
Entry
THI_3344          CDS       T02347                                 

Gene name
aceB
Definition
(GenBank) Malate synthase A (MSA)
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00620  Pyruvate metabolism
thi00630  Glyoxylate and dicarboxylate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01200  Carbon metabolism
Module
thi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THI_3344 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    THI_3344 (aceB)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     THI_3344 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CAZ89940
UniProt: D6CN12
Position
3255753..3257339
Genome map
AA seq 528 aa AA seqDB search
MTTPSAPQGVTLNAPLQPGFDRILTPDALAFVAQLHRAFEPRRQALLAARAARTARLDAG
EKPDFLAETRAVREGDWKIAPLPQALQRRRVEITGPVDRKMIINAFNSGADSYMADFEDA
NTPNWANQIEGQINLFDAIRRTIHLAQNGKTYALGDTIATLQVRPRGWHLDEKHLLVDGQ
RVSGSLFDFGLFFFHNARELIARGAGPYFYLPKMESHLEARLWNEVFVLAQNTLGLPQGS
IKATVLVETILAAFEMDEILFELREHSAGLNAGRWDYIFSAIKKFKVDHDFCLADRSQIT
MTVPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDAEKNAKAMEGIRMDKRRDATDGY
DGGWVAHPGLVSVAMEEFVAVLGDAPNQIGKTRDDVNVGAADLLDFRPEAPITEAGLRNN
INVGVHYLGAWLAGSGAVPIHNLMEDAATAEISRSQVWQWIQSPKGVLSDGRKVTADLVR
AIIPEELAKVKATGATGQFDKAAQIFEQMATSAQFTDFLTLPLYEELS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccccttccgcccctcagggcgtcaccttgaacgccccgctgcagccgggcttc
gaccgcatcctcactcccgacgcgctggccttcgtcgcccagttgcaccgcgctttcgag
ccgcgtcgtcaggccctgctggcggcccgtgcggcccgcactgcccgcctcgacgccggt
gaaaaacccgatttcctcgccgagactcgggcggtgcgcgagggcgactggaaaatcgcc
ccgctgccccaggcgctgcagcgtcgccgcgtggagatcaccggcccggtggatcgcaag
atgatcatcaacgccttcaattcgggcgccgacagctatatggccgacttcgaggatgcc
aacacgccaaactgggccaaccagatcgaagggcagatcaatctgttcgacgccattcgc
cgcaccatccatctggcgcagaacggcaagacttacgcgctgggcgacaccatcgccacc
ctgcaggttcgcccgcgcggctggcatctggacgaaaaacatctgctggtggacggccag
cgggtgagcggcagcctgttcgatttcgggctgttctttttccacaacgcccgcgagctg
atcgcgcgcggcgctggcccctacttttacctgcccaagatggaaagccatctggaagcg
cggttgtggaacgaggttttcgtgctggcgcaaaacaccctgggcctgccgcagggctcc
atcaaagccaccgtgctggtggaaaccatcctcgccgcgttcgagatggacgagattctg
tttgagttgcgcgagcacagcgccgggctgaacgcgggccggtgggattacattttcagc
gccatcaagaagttcaaagtggatcacgacttctgcctggccgaccgttcgcagatcacc
atgacggtgccgttcatgcgcgcctacgccctgctgctgctcaagacctgccacaagcgc
ggcgcgccggccattggcggcatgagcgcgctcatccccatcaagaacgacgcggagaaa
aacgccaaggccatggagggcatccgcatggacaagcgtcgtgacgccaccgacggctac
gacggtggctgggtggcgcatccgggactggtgtcggtggcgatggaagagttcgtcgcc
gtgctcggcgacgcgcccaaccagatcggcaaaacccgcgacgatgtcaatgtgggcgct
gccgacttgctggacttccgcccggaagcccccatcaccgaagccgggctacgcaacaac
atcaacgtcggcgtccactacctcggcgcgtggctggcgggcagcggcgccgtgcccatc
cacaatctgatggaagacgcggccaccgccgaaatctcgcgcagccaggtgtggcaatgg
attcagagccccaagggcgtgctgagcgacggccgcaaagtcactgccgatctggtgcgc
gcgatcatcccggaggaactcgccaaggtcaaagccaccggcgcgacgggccagttcgac
aaggccgcgcagatcttcgagcagatggccactagcgcgcagttcaccgacttcctcacc
ctgccgctgtatgaggaactgagctga

DBGET integrated database retrieval system