KEGG   Thiomonas arsenitoxydans: THI_3344Help
Entry
THI_3344          CDS       T02347                                 

Gene name
aceB
Definition
Malate synthase A (MSA) (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THI_3344 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THI_3344 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    THI_3344 (aceB)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     THI_3344 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3255753..3257339
Genome map
AA seq 528 aa AA seqDB search
MTTPSAPQGVTLNAPLQPGFDRILTPDALAFVAQLHRAFEPRRQALLAARAARTARLDAG
EKPDFLAETRAVREGDWKIAPLPQALQRRRVEITGPVDRKMIINAFNSGADSYMADFEDA
NTPNWANQIEGQINLFDAIRRTIHLAQNGKTYALGDTIATLQVRPRGWHLDEKHLLVDGQ
RVSGSLFDFGLFFFHNARELIARGAGPYFYLPKMESHLEARLWNEVFVLAQNTLGLPQGS
IKATVLVETILAAFEMDEILFELREHSAGLNAGRWDYIFSAIKKFKVDHDFCLADRSQIT
MTVPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDAEKNAKAMEGIRMDKRRDATDGY
DGGWVAHPGLVSVAMEEFVAVLGDAPNQIGKTRDDVNVGAADLLDFRPEAPITEAGLRNN
INVGVHYLGAWLAGSGAVPIHNLMEDAATAEISRSQVWQWIQSPKGVLSDGRKVTADLVR
AIIPEELAKVKATGATGQFDKAAQIFEQMATSAQFTDFLTLPLYEELS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccccttccgcccctcagggcgtcaccttgaacgccccgctgcagccgggcttc
gaccgcatcctcactcccgacgcgctggccttcgtcgcccagttgcaccgcgctttcgag
ccgcgtcgtcaggccctgctggcggcccgtgcggcccgcactgcccgcctcgacgccggt
gaaaaacccgatttcctcgccgagactcgggcggtgcgcgagggcgactggaaaatcgcc
ccgctgccccaggcgctgcagcgtcgccgcgtggagatcaccggcccggtggatcgcaag
atgatcatcaacgccttcaattcgggcgccgacagctatatggccgacttcgaggatgcc
aacacgccaaactgggccaaccagatcgaagggcagatcaatctgttcgacgccattcgc
cgcaccatccatctggcgcagaacggcaagacttacgcgctgggcgacaccatcgccacc
ctgcaggttcgcccgcgcggctggcatctggacgaaaaacatctgctggtggacggccag
cgggtgagcggcagcctgttcgatttcgggctgttctttttccacaacgcccgcgagctg
atcgcgcgcggcgctggcccctacttttacctgcccaagatggaaagccatctggaagcg
cggttgtggaacgaggttttcgtgctggcgcaaaacaccctgggcctgccgcagggctcc
atcaaagccaccgtgctggtggaaaccatcctcgccgcgttcgagatggacgagattctg
tttgagttgcgcgagcacagcgccgggctgaacgcgggccggtgggattacattttcagc
gccatcaagaagttcaaagtggatcacgacttctgcctggccgaccgttcgcagatcacc
atgacggtgccgttcatgcgcgcctacgccctgctgctgctcaagacctgccacaagcgc
ggcgcgccggccattggcggcatgagcgcgctcatccccatcaagaacgacgcggagaaa
aacgccaaggccatggagggcatccgcatggacaagcgtcgtgacgccaccgacggctac
gacggtggctgggtggcgcatccgggactggtgtcggtggcgatggaagagttcgtcgcc
gtgctcggcgacgcgcccaaccagatcggcaaaacccgcgacgatgtcaatgtgggcgct
gccgacttgctggacttccgcccggaagcccccatcaccgaagccgggctacgcaacaac
atcaacgtcggcgtccactacctcggcgcgtggctggcgggcagcggcgccgtgcccatc
cacaatctgatggaagacgcggccaccgccgaaatctcgcgcagccaggtgtggcaatgg
attcagagccccaagggcgtgctgagcgacggccgcaaagtcactgccgatctggtgcgc
gcgatcatcccggaggaactcgccaaggtcaaagccaccggcgcgacgggccagttcgac
aaggccgcgcagatcttcgagcagatggccactagcgcgcagttcaccgacttcctcacc
ctgccgctgtatgaggaactgagctga

DBGET integrated database retrieval system