KEGG   Thiomonas sp. 3As: THI_3344Help
Entry
THI_3344          CDS       T02347                                 

Gene name
aceB
Definition
Malate synthase A (MSA) (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
thi  Thiomonas sp. 3As
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:thi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:thi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:thi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3255753..3257339
Genome map
AA seq 528 aa AA seqDB search
MTTPSAPQGVTLNAPLQPGFDRILTPDALAFVAQLHRAFEPRRQALLAARAARTARLDAG
EKPDFLAETRAVREGDWKIAPLPQALQRRRVEITGPVDRKMIINAFNSGADSYMADFEDA
NTPNWANQIEGQINLFDAIRRTIHLAQNGKTYALGDTIATLQVRPRGWHLDEKHLLVDGQ
RVSGSLFDFGLFFFHNARELIARGAGPYFYLPKMESHLEARLWNEVFVLAQNTLGLPQGS
IKATVLVETILAAFEMDEILFELREHSAGLNAGRWDYIFSAIKKFKVDHDFCLADRSQIT
MTVPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDAEKNAKAMEGIRMDKRRDATDGY
DGGWVAHPGLVSVAMEEFVAVLGDAPNQIGKTRDDVNVGAADLLDFRPEAPITEAGLRNN
INVGVHYLGAWLAGSGAVPIHNLMEDAATAEISRSQVWQWIQSPKGVLSDGRKVTADLVR
AIIPEELAKVKATGATGQFDKAAQIFEQMATSAQFTDFLTLPLYEELS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccccttccgcccctcagggcgtcaccttgaacgccccgctgcagccgggcttc
gaccgcatcctcactcccgacgcgctggccttcgtcgcccagttgcaccgcgctttcgag
ccgcgtcgtcaggccctgctggcggcccgtgcggcccgcactgcccgcctcgacgccggt
gaaaaacccgatttcctcgccgagactcgggcggtgcgcgagggcgactggaaaatcgcc
ccgctgccccaggcgctgcagcgtcgccgcgtggagatcaccggcccggtggatcgcaag
atgatcatcaacgccttcaattcgggcgccgacagctatatggccgacttcgaggatgcc
aacacgccaaactgggccaaccagatcgaagggcagatcaatctgttcgacgccattcgc
cgcaccatccatctggcgcagaacggcaagacttacgcgctgggcgacaccatcgccacc
ctgcaggttcgcccgcgcggctggcatctggacgaaaaacatctgctggtggacggccag
cgggtgagcggcagcctgttcgatttcgggctgttctttttccacaacgcccgcgagctg
atcgcgcgcggcgctggcccctacttttacctgcccaagatggaaagccatctggaagcg
cggttgtggaacgaggttttcgtgctggcgcaaaacaccctgggcctgccgcagggctcc
atcaaagccaccgtgctggtggaaaccatcctcgccgcgttcgagatggacgagattctg
tttgagttgcgcgagcacagcgccgggctgaacgcgggccggtgggattacattttcagc
gccatcaagaagttcaaagtggatcacgacttctgcctggccgaccgttcgcagatcacc
atgacggtgccgttcatgcgcgcctacgccctgctgctgctcaagacctgccacaagcgc
ggcgcgccggccattggcggcatgagcgcgctcatccccatcaagaacgacgcggagaaa
aacgccaaggccatggagggcatccgcatggacaagcgtcgtgacgccaccgacggctac
gacggtggctgggtggcgcatccgggactggtgtcggtggcgatggaagagttcgtcgcc
gtgctcggcgacgcgcccaaccagatcggcaaaacccgcgacgatgtcaatgtgggcgct
gccgacttgctggacttccgcccggaagcccccatcaccgaagccgggctacgcaacaac
atcaacgtcggcgtccactacctcggcgcgtggctggcgggcagcggcgccgtgcccatc
cacaatctgatggaagacgcggccaccgccgaaatctcgcgcagccaggtgtggcaatgg
attcagagccccaagggcgtgctgagcgacggccgcaaagtcactgccgatctggtgcgc
gcgatcatcccggaggaactcgccaaggtcaaagccaccggcgcgacgggccagttcgac
aaggccgcgcagatcttcgagcagatggccactagcgcgcagttcaccgacttcctcacc
ctgccgctgtatgaggaactgagctga

DBGET integrated database retrieval system