KEGG   Thiomonas arsenitoxydans: THI_3728Help
Entry
THI_3728          CDS       T02347                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01130  Biosynthesis of antibiotics
thi01230  Biosynthesis of amino acids
Module
thi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THI_3728 (trpC)
Enzymes [BR:thi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     THI_3728 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAZ90303
UniProt: D6CP25
Position
complement(3630188..3630976)
Genome map
AA seq 262 aa AA seqDB search
MSDILQRILATKAQEVAAAREQVPLSALREQAAARDAPRGFAAAVQAKVATGGPAVIAEV
KKASPSRGVLRADFDPAAIARSYAAGGATCLSVLTDVQYFQGAASYLQQARAACALPVLR
KDFMVDAYQIAEAAAMGADCVLLIAAALPQAQLIELEAEAMSYGLDVLVEVHNAAELEAA
LALRTPLLGINNRDLRSFETRLETTLDLLPQIPEGRVVVTESGILTADHVARMRAAGVQA
FLVGEAFMRADDPGTALRALFD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatccttcagcgcatcctcgccaccaaagcgcaagaagtggcggcagcgcgc
gagcaggtgcctttatcggcgctgcgcgagcaggctgcggcgcgtgacgcgccgcggggg
tttgccgccgcggtgcaggccaaagtcgccacgggtgggcccgccgtcattgcggaagtg
aaaaaggccagtccgtcgcgcggggttctgcgggccgacttcgatccggccgcgattgct
cgcagctacgcggccgggggcgccacctgcttgtccgtgctcaccgatgtgcagtacttc
cagggggcggcgtcttatctgcagcaggcgcgggcggcttgcgcgctgcccgtattgcgc
aaggatttcatggtcgacgcctaccagatcgccgaggctgcagcgatgggggctgactgc
gtgctgttgatcgccgccgctctgccgcaggcgcaattgatcgaactggaagccgaggcg
atgagctacggccttgatgtgctggtcgaggtacacaacgcggctgaactggaggcggcg
ctggcgctgcgcacgcctctgcttggcatcaacaaccgcgacttgcgcagctttgaaacc
cggctggagaccaccctcgatctgctgccgcagattcctgagggccgcgtcgttgtgacc
gaaagcggcattctgaccgccgatcacgtcgcacgcatgcgggccgccggcgttcaggcc
ttcctcgtcggcgaagccttcatgcgcgcggacgaccccggcacggccctgcgcgcgctc
ttcgattga

DBGET integrated database retrieval system