KEGG   Tarenaya hassleriana (spider flower): 104818509Help
Entry
104818509         CDS       T04125                                 

Definition
(RefSeq) acid beta-fructofuranosidase 3, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104818509
   00500 Starch and sucrose metabolism
    104818509
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104818509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 104818509
NCBI-ProteinID: XP_010546426
Position
Unknown
AA seq 682 aa AA seqDB search
MVSSGATLPITDPVPYTPLPDGSGSDPDPDPSRRRRPIFGPLAVSSGLFLIALYAALIAT
HDGSSPRAVVIDAGNATVAAKTRERIAGVSEKSGERWRFSGIRNGDPAMAEFPWDNSMLT
WQRTAFHFQPEKNWMNDPNGPLFYKGWYHLFYQYNPKGAAWGDIIVWGHAVSEDLIHWLH
LPLAMVPDQWYDANGVWTGSATTLDDGSVVMLYTGSTHEFAQVQNLAYPKDPNDPLLLQW
EKYSGNPVLVSPPGIHRKDFRDPTTAWRTSAGKWRLTIGSKVNRTGISLLYDTADFKTFQ
QLPSLLHQVPDTGMWECVDFFPVSTTSVNGLDTSVNGPEVRHVMKASMDETRIDYYAIGT
YFEENGTWVPDDATMDVGFGLRYDYGKFYASKTFYDQNKGRRILWSWVSESDSESADVKK
GWSSLQSIPRTVALDTKTGKNLVQWPVEEIESLRLNSTEFKVEVGPGTIVPVDVGPAAQL
DIEAEFEIEKAALERLAGDSAAAEEELSCRGAASRGALGPFGLSVISDEGLSEQTPVYFY
VTKGKDSKLKTFFCTDTSRSSVANDVDKGIYGGFTPVFEGEKLTMRILVDHSIIEGFGQG
GRTCITTRVYPTKAIYEGAKLFLFNNATGANVTASFKVWQMNNAFIHSSPDYDLPLTKNF
TIRGIFVFTVLSFVLYLLYRSF
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggtgagctccggcgcaacattgccgatcaccgacccggttccgtacactccgttaccc
gacgggtcaggatccgacccggatccggatccgtcccgccgtcggcggcccatattcgga
ccactcgccgtgtcctccggcctcttcttgatcgctttgtacgcagctctcatcgccact
cacgacgggtcctcgcctcgggctgtcgtcatcgacgcgggaaatgcgaccgtcgcggcg
aagacacgtgaacgtatcgccggagtctcggagaagagcggcgaacggtggagattctcc
ggcatccggaacggagatccggcgatggcggagttcccatgggacaacagcatgctgacg
tggcagaggacggccttccattttcagcccgagaagaattggatgaacgatcctaatggg
ccattgttctacaagggatggtaccatttattctaccaatataacccaaagggagccgcg
tggggagacattattgtttggggccatgccgtctcagaggacctgatccattggctccat
cttcccttagccatggtccctgatcaatggtacgatgccaatggcgtctggaccggctct
gccaccactctcgacgatggctcagtcgtcatgctctacaccggttccacccatgagttt
gcccaggttcaaaacttggcttaccctaaggacccaaacgacccacttcttctacaatgg
gagaaatattccggcaaccctgtcctcgtttctccaccggggatccaccgcaaagacttc
cgagatccgaccaccgcatggcgtacttccgctggaaaatggcgtctaaccatcggctcc
aaggtcaaccgcaccggaatctccctcctctacgacacagccgacttcaagactttccaa
cagctcccctcgttgttgcaccaagttccggacaccggcatgtgggagtgcgttgacttt
ttccctgtctcgacgacatcggtcaacggtctcgacacatcggtcaacggcccagaagtc
aggcacgtcatgaaggctagtatggacgaaacgaggatcgattattacgcgatcgggacc
tactttgaagagaacgggacgtgggttccggacgatgcaacgatggatgtcgggttcgga
ttgaggtacgattacgggaaattctacgcatcgaagacgttttacgatcagaataagggc
cggagaatcttgtggagttgggtcagcgagtctgatagcgagtctgctgatgtaaagaag
ggttggtcctctcttcagagcattccaagaaccgtagccctagacacaaagactggtaag
aacctggttcaatggcccgtcgaagaaattgaatctctaagactgaacagcacggaattc
aaggtagaggtcggaccagggaccatagttccggtagacgtgggcccggcggctcagctc
gacattgaggccgagttcgagatcgagaaggcggctcttgaaagattagccggagactca
gcagcggccgaggaggaactcagctgcagaggagcggcgagccgtggggccctcggaccg
ttcgggttgtcggtaatctccgacgagggcttgtcggagcaaactccggtttacttctat
gtcactaagggcaaagattcaaagctcaagactttcttctgcacagatacctcaaggtcg
tcagtggcaaacgatgtcgacaaaggcatatacggtggcttcacaccagtattcgaagga
gagaaattaaccatgagaatactggtggaccattcgataatagaaggattcggacaagga
gggagaacgtgtatcacgacaagggtgtatccgacaaaggcgatatacgaaggagccaag
ttgtttttgttcaacaacgccaccggagctaacgttacggcgtcgtttaaggtgtggcag
atgaacaatgctttcattcactcctcacctgattacgatcttcccctaacaaagaatttt
actattagaggaatttttgtttttaccgttctctcttttgtattatatctcctttaccgt
tcgttttga

DBGET integrated database retrieval system