KEGG   Tarenaya hassleriana (spider flower): 104824637Help
Entry
104824637         CDS       T04125                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6 isoform X2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104824637
   00500 Starch and sucrose metabolism
    104824637
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104824637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Rho_GDI
Motif
Other DBs
NCBI-GeneID: 104824637
NCBI-ProteinID: XP_010555046
Position
Unknown
AA seq 560 aa AA seqDB search
MEYSCEENANFGNMLLQVNQSDESSQPYRTSFHFQPPKNWLNDPNGPMYYKGMYHLFYQH
NPSSPLFGDIMIWAHSVSRDLVNWAHLKPALCPSDSYDINSCWSGSATILPSGKPVILYT
GIDSKKHQVTNLVEPKDDSDPLLQEWVKSEKNPVMVPPSDVEVDCFRDPTTAWQGLDGKW
RVLVGAKTRDSSRGVALLYHSDDFVRWTKFPNPLFGSEVTGMWECVDFFPVSINGTIGVE
TSVNSECVRHVLKASYGGHDCYVVGSYDPETEKFLADSDFSGSVSDLRLDYGTYYASKTF
FDNAKNRRISWGWVYELDSKEDAIEKGWSGLMSLPREIWLDESGKRLVQRPVEELKNLRA
NRVCLHRKKLEGGSVLEVSGITASQADIEVVFELPDLEDDEEEVEFLDSDQSDPQELCKA
SVQGVYGPFGLLTLASKDMSEQTAIFFRVFRCHEGYSILMSSDHSKSSLTTNVDKSSHGT
FLDMDPKHGKISLRCLIDHSIIESYGGGGRSVMTSRVYPKLAIGEEVYLHVFNNGTKTVT
LSSLEAWSMTKAHFNSNDIQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggaatattcttgtgaggaaaatgcaaactttgggaatatgcttcttcaagtcaaccaa
tcggacgaatccagtcaaccttacagaacttccttccatttccaacctcccaaaaactgg
ctcaatgatcccaacgggccaatgtattacaaagggatgtaccatttgttctaccaacac
aacccgtctagtcctttgttcggagacatcatgatatgggcacactccgtttcacgcgat
ctcgtcaactgggcccatctcaagcccgccctttgtccctcggattcatacgatatcaac
agctgctggtcgggatccgcgacgatccttcccagtggcaaacctgtaattctgtacacc
gggatcgactccaagaaacaccaagtgacgaatcttgtcgaaccaaaagatgattctgac
cctttactccaagaatgggtaaaatccgagaaaaatccggtgatggttccaccatctgac
gtagaggttgattgttttcgggaccctacgaccgcatggcaggggctggatgggaaatgg
agagttctggtcggagctaagacaagagacagtagcagaggagttgctctgttgtatcac
agcgatgattttgtcaggtggacgaagtttccgaaccctcttttcggatcagaagtgacg
gggatgtgggaatgtgtagatttcttcccagtttctatcaatggcacaattggcgttgag
acttcggtgaacagcgaatgtgttaggcatgtcctgaaagcaagttatggaggacatgac
tgttatgttgtcggttcatatgatcccgagacggagaaattcttggcggattctgatttc
tcgggttcagtctctgatctaagacttgattatggaacgtactatgcatcgaaaacgttt
ttcgataatgcaaaaaaccgaaggatttcgtggggttgggtatacgagttggatagcaaa
gaagatgccattgagaaaggatggtccggtcttatgtctctaccaagggagatttggcta
gatgaatctggaaagaggttagtacaaagaccagttgaagaactcaagaatctccgagcc
aaccgagtttgcttgcatcgcaagaaactcgaaggaggatcggttcttgaagtttcgggc
atcactgcatcacaggcggatatcgaagtagtttttgaactacctgatctagaagatgat
gaagaagaagtagagttcttggattcagaccaatctgatcctcaagaactatgcaaggcg
tcggtccaaggcgtctatggcccttttggattgctaacattggcgagtaaggacatgtcg
gagcaaacagcgatcttcttccgagtttttcgctgtcatgagggatattcgatcctcatg
agcagcgatcatagcaaatcttcattaacaaccaacgtcgacaaatcctcgcacgggaca
ttcctagacatggatccgaaacacgggaagatctcattaagatgcttgatcgatcactcg
atcatagagagctatggaggaggaggaagaagtgtgatgacaagtagggtttatccgaaa
ctagcgattggtgaagaagtttaccttcatgtcttcaacaatggaaccaagactgtcact
ctctcgtctttggaagcttggagcatgacaaaagcccacttcaactccaacgacatccaa
tga

DBGET integrated database retrieval system