KEGG   Tetragenococcus halophilus: TEH_01240Help
Entry
TEH_01240         CDS       T01640                                 

Gene name
acoC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:thl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:thl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:thl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141149..142351
Genome map
AA seq 400 aa AA seqDB search
MATEIIMPTLGLTMTEGTVDTWLKGEGDQVEKGEAVCTISSEKLSHDVEAPAEGTLIKIL
VPTGEVAPCKDAIGLIGEPGEEVSSKTEKKDTTEETPEEPSDKKPEPVKPKEEKAKGDRI
FITPLARKVAKEQGIDYSQINGTGGNGRITRRDVEMFEPQEESVAATTTTSVGTGLTGMR
KTIAQRMTSSLQNTAQVTVQQKADVTQLMAFRKEMKENAGIPLTDGQMSITTLLSKATTL
ALQETPKMNALYHDGKLEEFAEVHLGMAVALDEGLIVPVVKNADKMTLTELGKTLNDRIE
KTKQGTLESENYSGSTFTITNLGKGGAEYFTPILNPPETGILGVGSMLNELVLDEKGQVV
QKQKLPLSLTFDHQVIDGAPAADFLSRVVEYLEMPYSLIL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaattattatgccgacattaggtttaacgatgacagaaggtacagtagat
acttggctgaaaggtgaaggagatcaagttgagaaaggagaagcggtatgtacaatcagc
tcagaaaagctcagccatgatgttgaagcaccagcagaaggaacacttataaaaatatta
gttcctactggtgaagtagctccttgtaaagacgccattggtttaatcggcgagccaggt
gaagaggtttcttcaaaaactgaaaaaaaagacacaaccgaagaaactccagaagaacca
tcagacaaaaaacctgaacctgtaaaaccgaaagaggaaaaagcaaagggcgatcggatt
ttcattactccgttagctagaaaagttgctaaagaacaaggtatcgattattctcaaatc
aatggcacgggtggcaatggacggatcacgcgacgtgatgtcgaaatgttcgaacctcaa
gaagaaagtgtagcagctacgacaacgacatcagtaggcactggtttaactggtatgagg
aaaacgattgctcaacgcatgacatcaagtctacaaaatactgctcaagtaacagttcaa
caaaaggctgacgtgactcaattgatggcttttaggaaagaaatgaaagaaaatgctggg
ataccattaacagatggacaaatgagtataaccactttattatccaaagcaacaacttta
gcattacaggaaacccctaaaatgaatgctttatatcatgatggaaaattagaagaattt
gctgaagttcacttaggtatggcagtggcgctagatgaaggactgattgttccagtggta
aaaaatgccgataaaatgacactgactgagttaggaaagactttaaatgatcgaatcgaa
aaaacaaaacaaggaacgttagagagtgaaaattatagcggttcgacattcaccatcact
aacttaggaaaaggcggcgcagaatactttactcctattttgaacccgccagaaacagga
atcttaggcgttggatctatgttgaatgaattagtacttgatgaaaaaggtcaagttgtc
caaaaacaaaaactacctttaagcttaacatttgatcaccaagtaattgatggtgctcct
gcagctgacttcctttctagagtggttgaatatttggaaatgccgtattcgttgatttta
taa

DBGET integrated database retrieval system