KEGG   Tetragenococcus halophilus: TEH_01340Help
Entry
TEH_01340         CDS       T01640                                 

Definition
(GenBank) peptidase M20 family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00300  Lysine biosynthesis
thl01100  Metabolic pathways
thl01120  Microbial metabolism in diverse environments
thl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TEH_01340
Enzymes [BR:thl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TEH_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: M20_dimer Peptidase_M20 Peptidase_M28 PG_binding_4 DUF965
Motif
Other DBs
NCBI-GeneID: 11258998
NCBI-ProteinID: BAK93461
UniProt: G4L3Z5
Position
152115..152954
Genome map
AA seq 279 aa AA seqDB search
MKSGLAALVIAMIEIKENNLLKQGTIRLMATTGEEVGEAGSQKFFEDGYSKDIDALVIAE
PSEDTIVNTHKGSMNFKITSTGQSAHSSMPHLGHNAINQLMGYLTKANKIFNEDRRENTT
LGKLVMSPTIFNGGNQVNSVPEYAQAELNVRTIPEFDNEEVKAIFNELANKYNSERHEID
VDIMMSLNSVFTDSDTLITKLAQSLGNKYFGSQPEIKSSPGVTDASNLLVDKPNNFNFIF
YGLGLTSMAHQTNEYVKKDVYVKFADLYKDLFIDLSEKL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgggtttagctgctttagttattgccatgatagaaatcaaagaaaataattta
ttgaaacaagggactattcgtttgatggctacaactggcgaagaggtcggtgaagctggt
tcacaaaaattttttgaggatggttactccaaagatatcgatgctttagtcattgccgaa
ccgtctgaagataccattgtaaacactcataagggctccatgaactttaaaattacttct
actggccaatcagcccatagctctatgcctcatttaggacataatgctattaatcaattg
atgggatatctaacaaaagctaataaaatttttaatgaagatcgtcgcgagaatactaca
cttgggaaacttgttatgagtccaactatttttaatggcggaaaccaagtaaattccgtt
ccagaatacgcccaagcagaattaaacgtacgtactattcccgaattcgataatgaagaa
gttaaagctatctttaatgagttagctaataagtataatagtgaacgtcatgagattgac
gtcgacattatgatgtccctaaacagcgtgttcactgattctgatactttgattacaaaa
ttagctcaatcattaggaaataagtattttggaagtcaaccagaaataaaatcttctcct
ggggttactgacgcatcaaacttacttgtagataaaccaaataacttcaattttattttc
tatggactcggtctaacaagtatggctcatcaaacaaatgaatacgttaaaaaagatgtt
tatgttaaatttgcagatttatacaaagacttattcattgatttatccgaaaaactataa

DBGET integrated database retrieval system