KEGG   Tetragenococcus halophilus: TEH_02660Help
Entry
TEH_02660         CDS       T01640                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
thl  Tetragenococcus halophilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TEH_02660 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TEH_02660 (gpo)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TEH_02660 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278365..278838
Genome map
AA seq 157 aa AA seqDB search
MATIYDFKETEMNGETLELSDYKGKVVVIVNTASKCGLAPQLETLESFYQKYKDQGFEVL
GLPSNQFHQELDSDDETDNYCKVHYGVTFPMTKRVEVNGNKEEPLFTHLKEAAGHGKIKW
NFTKFLVGRDGEVIKRYAPQTKLEKMEEDITEALKTE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatttatgatttcaaggaaacagaaatgaacggagaaacgcttgagttaagt
gattacaaaggcaaggttgttgtcattgtaaacactgctagtaaatgtggacttgcgcct
caacttgagacacttgaatctttctatcaaaaatataaggatcaaggatttgaagtgtta
ggtttgccttcaaaccaatttcatcaagaactagacagtgatgatgaaacagataattat
tgtaaagtccattatggcgttactttcccaatgactaaaagggttgaagtaaatggaaac
aaagaagaaccgctatttacccacttaaaagaggcagctggtcatggaaagattaaatgg
aattttacgaaatttctagtggggcgagacggagaagttattaaacgatacgcgccacaa
accaagctagagaaaatggaagaagatattaccgaagcactaaaaacagagtaa

DBGET integrated database retrieval system