KEGG   Tetragenococcus halophilus: TEH_02690Help
Entry
TEH_02690         CDS       T01640                                 

Gene name
xfp
Definition
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
thl  Tetragenococcus halophilus
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TEH_02690 (xfp)
Enzymes [BR:thl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     TEH_02690 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(279931..282294)
Genome map
AA seq 787 aa AA seqDB search
MSVNIDSKEYLERMNAWWRAANYISVAQIFLRDNPLLRRPLEKEDIKINPIGHWGTISGQ
NFIYVHLNRVINKYGLNMFYIEGPGHGGQVMVSNSYIDGSYSEIYPDVTQDEAGLKKLFK
QFSFPGGMGSHAAPETPGSIHEGGELGYSMSHAVGAVLDNPDVIAATVIGDGEAETGPLA
ASWMSNNFINPVNDGAVLPILNLNGAKIANPTVLARKSDKDLQKYFEGLGWKPYFVEGDN
PEKMHPLMAETLDAVINEIQSIQKEARKGSAEDVTMPHWPVIVFRTPKGWEGPEKWDNEQ
IAGTFRAHQVPIPIDASHMEYANDLAKWLKSYRPEELFDENGTIIDAIKELSPKGDNRMS
VNPITNGGLDPKALNMPDWHTHAVDTSKRGTDKAQDMSVLGGFIADIMENNPKNFRIFGP
DETKSNRLNKVFDVTNRQWVEPRELSDEWQSAVGRVIDGQLSEHQAEGFLEGYTLTGRHG
FFASYEAFLRIVDSMLTQHFKWIRKANEKSWRKKYPSLNVISSSTAFQQDHNGYTHQDPG
VITHLAEKKPEYIREYFPADANSLMAVMDKALKDENVINLITSSKHPRPQFYSVEEAQEL
VDYGVKKIDWASNDQDSEPDIVFAAAGSEPNLEALAAISILHEQFPEMKIRFINVVDLLK
LRHPDVDPRGLSDEAFDELFTTDKPVIFNFHGYEGLIRDIFFTRHNRNLSIHGYREDGDI
TTPFDMRVKNELDRFHLAKDAANTIYAEKAADFIQEMDKTLQYHHDYIRENGDDISEVQN
WEWKDLK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaatatcgattcaaaagaatatctagaaagaatgaacgcatggtggcgcgca
gcaaattatatttctgtcgcacaaatttttctaagagacaatcctttgttacgtcgtcct
cttgaaaaagaagatataaaaattaatcctattggtcattggggaactatctcaggacaa
aactttatctatgttcatttaaatcgtgtgattaataaatatggtttaaacatgttctac
attgaaggaccaggacatggtggacaagtaatggtatctaactcctatattgatggtagt
tattcagaaatttatccagatgtcacacaagatgaagcgggtttgaaaaaattatttaaa
caattttcttttcctggtggtatgggttctcacgcagcaccagaaacgccaggttcaatc
cacgaaggtggcgaattgggctactcaatgtcccatgctgttggtgcggttttagataac
cctgatgttattgcagcaacagttattggcgatggtgaagcagaaacaggcccactagcc
gctagctggatgtctaataactttattaaccctgtaaatgatggtgcagttttgcctatt
ttaaacctaaatggtgctaaaatcgctaatcctactgtgctagctcgtaaaagcgataaa
gatttgcagaaatattttgaaggcttgggctggaaaccttactttgttgaaggtgataat
cctgaaaaaatgcatccattaatggcagaaacattggacgctgttattaatgaaattcaa
tcgattcaaaaagaagctcgtaaaggttcagctgaagatgtaactatgccgcattggcca
gtcattgttttccgtacaccaaaaggttgggaaggcccagaaaaatgggataatgaacaa
attgctgggactttccgtgcgcaccaagtaccaattccgatagatgcaagtcatatggaa
tatgcaaatgacctagcaaaatggttgaaatcttaccgtcctgaagaattgtttgatgaa
aatggcacgattattgatgcaattaaagaactttcgcctaaaggtgacaatagaatgtca
gttaaccctattactaatggcggacttgaccctaaagctcttaatatgcccgattggcac
acgcatgcagtagacaccagcaagcgcggtacagataaagcacaagatatgtctgttcta
ggtggttttattgcagatattatggaaaataatcctaaaaatttccgtatttttggacca
gatgaaacaaaatcaaatcgtttaaacaaagtattcgacgttacaaatcggcaatgggta
gaacctagagaattatccgatgaatggcaatctgctgtgggtcgtgtgattgatggacaa
ttatcagaacaccaagctgaaggtttcttagaaggttatactcttactggacgtcatggt
ttctttgcaagctatgaagctttcttgcggatcgtagattcaatgttaacacaacacttt
aagtggattagaaaagcaaatgaaaaaagctggcgtaagaaatatccatctttgaatgta
atttcttcatcaacagcgttccaacaagaccataatggatatactcatcaagacccaggc
gttattactcatttagctgagaaaaaacctgaatatattagagaatatttcccggctgat
gcaaacagcttgatggctgttatggataaagctttaaaagatgaaaatgtcatcaacttg
attacatctagtaagcatccaagaccacaattttattccgtcgaagaagcacaagaactt
gtcgattacggcgtgaagaaaattgattgggcaagtaacgatcaagacagcgaacctgat
atcgtatttgcagctgctggttcggaaccaaacttagaagcgctagcagctatctcgatc
ttacatgaacaattccctgaaatgaagattcgttttattaacgttgtcgatcttttgaaa
ctacgtcatcccgatgtagacccacgtggtttaagcgatgaagcatttgatgaattgttt
acaacagataaacctgttatctttaacttccacggttatgaaggattgattcgtgacatc
ttctttacacggcacaaccgtaatctaagcattcatggctatcgtgaagatggagacatc
acaacaccatttgatatgcgggttaaaaatgaattggatcgcttccatttggccaaagac
gctgctaataccatttatgcagaaaaagcagctgattttattcaagaaatggataaaact
ttacaatatcatcatgattatattcgtgaaaatggtgatgatattagtgaagtacaaaat
tgggaatggaaagatttgaagtaa

DBGET integrated database retrieval system