KEGG   Tetragenococcus halophilus: TEH_03630Help
Entry
TEH_03630         CDS       T01640                                 

Definition
putative glycosidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
thl  Tetragenococcus halophilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TEH_03630
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TEH_03630
Enzymes [BR:thl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TEH_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375827..376996
Genome map
AA seq 389 aa AA seqDB search
MKKKGVIISLVGVLLVVCAASVWAMTRNQETKTATSTTSNSSSQTTMTSSSEEEDNITTM
IDKMSLEEKVGQLFFARTPQENQVSDLEDYHLGGYVLFGEDTENATKESLQEKVQSFQEA
SDIPLLIGSDEEGGTVTRISNNPELVDQPFKGPQEIYAEDGWQGIIQDTKQKAGILEDLG
INAGLFPDADVSTDEESFIYDRTIGMDAKGTSEYVKNVVETLNEAQSGSTLKHFPGYGDN
RDSHVEIVEDDRSLDELRENDFLPFEAGIKAGADSVLVSHNIVNSIDPKAPASISPEVHK
ILREELNFDGVVMTDDMDMAGLADFIPQEDAGLEALKAGNDMVMSSSYQSQIPAVIQAVE
DGDYAEEELEASVERVLAWKEDLGILFKK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaggcgttattattagtttagtgggtgttttgttggtggtttgcgcggct
agtgtttgggcgatgactcgcaatcaggagacaaaaactgcgacaagtactacaagcaat
tctagctcacaaacaacgatgactagtagttcagaagaggaagataatattactacaatg
atcgataaaatgtcattagaagaaaaagtcggtcagttattttttgcacggacgccacaa
gaaaatcaagtgtctgatctagaagattatcatctaggcggctatgttttatttggtgag
gatacggaaaatgcgacaaaagaaagcttacaagagaaagttcaatcttttcaagaagca
agcgatattcctcttttaattggctcggatgaagaaggcgggacagtgacacggatcagc
aataatcctgaattagtggatcagccttttaaaggaccgcaagaaatatatgcagaagac
ggttggcaaggaattattcaagatacaaaacaaaaggcagggattcttgaggacttaggc
attaatgcaggattgtttcctgacgctgatgtttccacagatgaagagtcttttatctat
gatcgaaccattggaatggatgcaaaaggaacaagtgaatatgtgaaaaacgtggtagaa
acattaaatgaagcacaaagcggttctaccttaaaacattttcctggttatggcgataac
cgcgattcgcatgtagaaattgtggaagatgatcgttctttagatgaattacgcgaaaat
gattttctaccctttgaagcagggattaaagctggtgcagatagtgtgctggtctctcat
aatattgtaaatagtatcgatccaaaagcgcctgcatctatttcacctgaagtgcacaaa
attttgcgcgaagaattaaactttgatggcgtagtcatgactgatgatatggatatggct
ggattagctgattttatcccacaagaagatgctggtctagaggcgttaaaagcagggaat
gatatggtaatgtcttctagttatcaatctcaaattcctgcagtcattcaagcagtggaa
gacggcgattatgcagaagaagaattggaggcttcagttgagcgtgtgttggcttggaaa
gaggatttaggcattttatttaaaaaatga

DBGET integrated database retrieval system