KEGG   Tetragenococcus halophilus: TEH_04400Help
Entry
TEH_04400         CDS       T01640                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00010  Glycolysis / Gluconeogenesis
thl00052  Galactose metabolism
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01130  Biosynthesis of antibiotics
Module
thl_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_04400 (galM)
   00052 Galactose metabolism
    TEH_04400 (galM)
Enzymes [BR:thl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TEH_04400 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Bac_surface_Ag DUF4942
Motif
Other DBs
NCBI-GeneID: 11259219
NCBI-ProteinID: BAK93767
UniProt: G4L5E3
Position
446873..447916
Genome map
AA seq 347 aa AA seqDB search
MRKENFGKNTKGQEVFLYTFENEQKMKMTVSNIGAVLTNLWIPDKDGNLRDVVLGYDTVT
DYENNGDTHFGATIGRNANRVENARFRLHDKIYRLAKNDGENNLHSGPNGYELRVWAVKK
IDEKNNSITFSLISPDKDQGYPGELHLDVTYQLQEIGIKITYSGISNTDTIFNPTNHSYF
NLNGHQSGNILNHKLQLNASRYTPIKDEHSIPTGKIVPVEGTPLDFTNKKQIGLDIQKNY
PQLKFSQGYDHNFVIDQKADVAAQLEGDQSGILMEIFTDFPGVQFYTSNFLENVQGKEKA
VYSRQSGVCLETQFFPNAINEPNFEAPMLKKDEENTYKTVYQFSIAL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagaaaatttcggtaagaatacaaaaggacaagaagtatttttatacactttt
gaaaatgaacagaaaatgaaaatgactgtcagtaatattggtgcagttctaacgaatctt
tggataccagataaagatggaaatttaagagatgtcgttttgggttatgatacagttact
gattatgaaaataatggagacacccattttggagcgactatcggacgtaacgcaaatcgc
gttgaaaatgctagattcagattacatgataaaatttacagattggcaaagaacgatggt
gagaacaatttacacagtggacccaatggctatgaattgagagtttgggcggtgaaaaaa
atagatgaaaaaaataattcgattactttttctcttataagtcctgataaagaccaaggt
tatcctggggaacttcacttagatgtgacttatcaactacaagagattgggataaagatt
acctatagtggaatatctaatacggatactatttttaaccctacgaatcatagttacttt
aacttaaatggacatcaaagcgggaatatattaaaccataaattacaacttaacgcgtca
aggtatacaccaatcaaagatgaacattctatacctactggaaaaatagtaccggttgaa
ggaacaccgttagattttacaaataaaaaacaaattggcttggatattcagaaaaattat
ccgcaattgaagtttagtcaaggctatgatcacaattttgttattgatcagaaggcagac
gttgcggcacaactggaaggagaccaaagcggcatcttgatggagatattcactgacttt
ccaggagtacaattttatacgagtaattttttagaaaatgtccaaggaaaagaaaaggcc
gtttattctagacaaagtggagtatgtttagaaactcaattctttccgaatgcgattaat
gaaccaaactttgaagctcctatgttaaaaaaggatgaagaaaatacttataagacggtt
tatcagttttctatagctctataa

DBGET integrated database retrieval system