KEGG   Tetragenococcus halophilus: TEH_06890Help
Entry
TEH_06890         CDS       T01640                                 

Gene name
recD
Definition
putative exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
thl  Tetragenococcus halophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TEH_06890 (recD)
Enzymes [BR:thl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TEH_06890 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712558..715098
Genome map
AA seq 846 aa AA seqDB search
MKGAACSLSEDNYIIGKIAAIFFRNPNNFYKVLLVKITETDMDYGEKEIVVTGSFGNVQE
EEFYRFFGERVVHPKYGEQFKANSYQKDQPTSETGLINYLSSDKFPGVGKKTAEKIVDLF
GEDAIDKILEEPSLLEQITGLTKKKREMLLDTIRLNYGMDKVIVGLNRYGFGSQLAFTIY
QTYKNETLEVIEENPYQLVEDIEGIGFKKADNIAEQLGIDATSDKRIRAAILHQILQQSM
ETGNTYIEAKKLLEQVLHILESSRPVEIDPEKVANGVIELVEEGKIQQEETALYENSLYF
AEWGIASSIQRLMQRKKEINYSENKVNKNLRKLEKRLGIVYGDSQEAAIKEAIKSPLFIL
TGGPGTGKTTVISGIVQLFAELNEIDLDPSQYSEETFPILLAAPTGRAAKRMNETTGLPS
STIHRLLGLNGRENNAKNADPKELEGGLLIVDEMSMVDTWLANTLFKSIPDNMQVIFVGD
KDQLPSVGPGQVLHDLLNVAEIPQKELTEIYRQGDGSSIIPLAHEIKNGQLPNDFIENQN
DRSYFSCQVQQIEPLISKVVLKAKEKGFTPQDIQVLAPMYKGPAGINALNKKMQEIFNAN
KEGTKKEVTFNDTVYRIGDKVLQLVNSPEDNVFNGDMGEITGIIYAKDSEDKVDELVIAF
DANEVVYKRNEWNKITLSYCCSIHKAQGSEFKMVILPMVNQYYRMLQRNLLYTAVTRSKE
MLILLGETSAYSRCVEQVSTLRLTALKERISGIDSISQAMRLKILSYENEQEEAPFEIGV
SKRKNNIKEKDATTKVVTSDLFEQSAEETSEMLSGELTEKMINEKAIDPMIGMGDLKPYD
FQISGK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagcggcttgttcattgtcagaagataattatatcattggtaaaattgcggcg
atttttttcagaaatcctaataatttttataaagtgcttctggttaagattactgaaaca
gacatggattatggtgaaaaagagatcgtggttacgggaagttttggtaatgttcaagaa
gaagaattttatcgtttttttggcgaacgtgtggttcatccaaagtatggtgaacaattt
aaagccaattcttaccaaaaggatcagccgacttctgaaacaggtttgatcaattatctt
tctagcgataaatttcctggtgttgggaaaaagactgctgaaaaaattgtcgaccttttt
ggagaggatgctattgataaaattttagaagaaccttccttactagaacaaattacaggt
ttgactaaaaaaaagcgggagatgctattagatacaattcgcctaaattatggtatggat
aaggtgattgtaggtttaaatcgctatggttttggtagccagttagcatttactatttat
caaacatataaaaatgaaacattagaggttattgaagaaaacccttatcaactggttgaa
gatattgaagggatcggttttaaaaaggctgacaatatcgccgaacagttgggtattgat
gcaacatcagataaaaggattcgtgcagcgatcttacaccaaattttacaacaatcaatg
gaaacaggaaatacttatattgaagctaaaaaactactagagcaagttttacatatattg
gagagtagtcgtcccgttgaaattgatccagaaaaagttgccaatggtgtaatcgagtta
gtagaagaaggtaaaatccaacaggaagaaacagccctttatgaaaatagtttgtatttt
gcggaatggggcattgcttcatctatccaacggctcatgcagcggaaaaaagaaattaat
tattcagaaaataaagtgaataaaaacttgcgaaaattagaaaaacgtttaggtatcgtt
tatggagattcgcaagaagcagccatcaaagaagctattaaatcccctttatttatctta
acaggtggaccaggaacaggaaaaactactgttatcagtggtatcgtacagttatttgct
gaattaaatgaaattgatttggatcctagccagtattcagaagagacctttcctatttta
ctagcagcaccgacaggacgtgccgctaaacggatgaatgaaacgaccggcctgcctagc
agtacgattcatcgtttactcggtttaaatggacgagaaaataatgcgaaaaacgccgat
cctaaagagcttgaaggaggacttttaattgttgacgaaatgtctatggtagatacttgg
ttagcaaataccttgtttaaatctattcctgataacatgcaggtaatttttgtgggagac
aaggaccaactgccctctgtaggacccgggcaggttttacatgatttattaaatgttgcc
gaaatcccacaaaaagaactgactgagatctatcgtcagggagatggttctagcatcatc
ccattagctcacgaaataaaaaatggacaactccctaatgattttatagaaaatcaaaac
gatcggtcttatttttcttgtcaggtacaacaaatcgaaccgttgatttctaaggtggtt
ttaaaggcgaaggagaaaggatttactccacaggatatccaagttttagcgcctatgtat
aaagggcctgctggcattaatgcattgaataaaaagatgcaagaaatttttaacgccaat
aaagaggggacaaaaaaagaagtcacttttaacgatacagtctatcgtattggtgataaa
gtgctgcagttggttaattcaccagaagataatgtatttaacggcgatatgggcgaaatt
acaggtatcatctatgcaaaagattcagaggataaagtggatgaattagtcattgctttt
gatgcaaatgaggtagtttataagcgcaatgagtggaacaagattacgctttcttattgt
tgttctattcataaagcacaaggcagtgaatttaaaatggttattttgcctatggtcaat
cagtattaccgtatgttacaacggaatttactctatacagctgtcactagaagtaaagag
atgctgattttactgggggaaacgtctgcttatagtcgttgtgttgaacaagtatcaacg
ctacgtttgactgctttaaaagaaagaatcagtggcatcgattcgatttcacaagcaatg
agattaaaaattttaagctatgaaaatgagcaagaagaagcaccgtttgaaattggcgta
agtaaaagaaagaacaacattaaagaaaaagatgcaacaacaaaagtagtgacttccgat
ttatttgaacaatcagctgaagagacttccgaaatgttatctggagagttaacagaaaaa
atgatcaatgaaaaagcgattgatcctatgattggtatgggcgatctcaaaccatatgat
tttcaaataagtggaaaataa

DBGET integrated database retrieval system