KEGG   Tetragenococcus halophilus: TEH_07050Help
Entry
TEH_07050         CDS       T01640                                 

Definition
putative 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_07050
Enzymes [BR:thl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TEH_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(725886..727286)
Genome map
AA seq 466 aa AA seqDB search
MSYKFPNNFLWGASISAHQTEGAYKNDGKGLTVQDTRIRDNHEIANFTVASDHYHHYKED
IQLLAELGVKVFRFSISWARIFPQGRKEINQAGIDHYQSVIDECLAHNIQPMVTLNHFDL
PQALEDMGGWSNRKTVDAFKEYAQTVFKAYGNKVKYWLTINEPNIMLLVDQKILGKQIPI
KEKYQQFHHLMMAEKYAFKFCHELVDNGQIGPVPNISLVYPATSKPLDNQAALYFNSVRN
WAYLDFSCFGRYNTVFKDYLKQKNISITFSPEDETVMKENFPDFIAMNFYTTMTVEKPMD
KNNMSEGISDQQSEDIMDWGFYKGVTNPYLKKNQFNWTIDPDGFKTTLQTLYDRYHLPII
ITENGLGAKDDLTEDKKIHDPYRIDYLKQHLEQALEAIEAGVDLFGYSPWSAIDLISVHE
GISKRYGFIYVDRTEKELKQLARYKKDSFYWYQKLIQTNKIPAESR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataaattcccgaataattttctatggggtgcatccatcagcgcacaccagaca
gaaggtgcttataaaaacgatggtaaaggattgactgtccaagatactaggatacgcgat
aatcatgaaattgccaatttcacagtagcaagtgaccattatcaccattataaagaagac
attcagttattagcagaactaggtgtcaaagtttttcgtttttcaatttcttgggcccgt
atttttcctcaaggtcgcaaagagatcaaccaagcaggtatcgatcattatcaaagtgtt
attgatgaatgtttagcacataatatccaacctatggtcacacttaaccactttgactta
ccacaagccttagaagatatgggcggttggtccaatcgtaaaacggttgatgcctttaaa
gaatatgcacaaaccgtttttaaagcctatggtaacaaggtcaaatactggttaacaatc
aatgaaccaaatatcatgctactggttgatcaaaaaattttaggaaaacaaattcctata
aaagaaaaatatcagcaattccatcatttgatgatggcagaaaaatacgcttttaagttt
tgccatgaactagtagacaatggacaaatagggcctgtgcctaatatatcattggtttat
ccagcgacaagtaaaccgttagataatcaggctgccttatatttcaatagtgtacgaaat
tgggcttatctcgatttttcttgttttggtcgttacaatacagtttttaaggactattta
aaacaaaaaaatatttctattactttttcacccgaagacgaaactgtaatgaaagaaaat
tttccagattttattgctatgaatttttatacaacaatgactgtagaaaaaccaatggac
aaaaataatatgagtgaaggaatcagtgatcaacaaagtgaagatataatggattggggt
ttttacaagggcgtcactaatccttatcttaagaaaaaccaatttaattggacgattgac
ccagatggctttaagactaccctacaaacactttatgatcgctatcatttgccaatcatt
atcactgaaaacggtctgggagccaaagatgatttaacggaagataaaaaaattcatgat
ccttaccgcattgattacttgaaacaacatcttgaacaagcactagaagctatcgaagca
ggtgttgatttatttggttatagtccttggtcagcgatcgatttgattagtgtccatgaa
gggatcagcaagcgttatggttttatttatgttgacagaacagaaaaagaattaaaacag
cttgcgcgttataaaaaggacagcttttattggtatcaaaaattaatccaaacaaataaa
atcccagcagaaagccggtga

DBGET integrated database retrieval system