KEGG   Tetragenococcus halophilus: TEH_07080Help
Entry
TEH_07080         CDS       T01640                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
thl  Tetragenococcus halophilus
Pathway
thl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:thl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TEH_07080 (recR)
DNA repair and recombination proteins [BR:thl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TEH_07080 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TEH_07080 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Toprim_2 NapD HHH
Motif
Other DBs
NCBI-GeneID: 11259403
NCBI-ProteinID: BAK94035
UniProt: G4L661
Position
729642..730238
Genome map
AA seq 198 aa AA seqDB search
MQYPEPIARLIASYMNLPGIGQKTATRLAFYTIDMKDEAVNDFAKSLLSVKRDLTYCSVC
GNITEDDPCEICADTTRDRSCVLVVEEPKDVMALEKMKEYQGLYHVLHGVLSPVEGTGPE
DINIPNLIKRLENEEIKEVIIATNASTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEVTLSKAVEGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatccagaacctattgctcgtttgattgcaagttatatgaacttaccaggtatc
ggccaaaaaacagcgacacgtttagctttttataccattgatatgaaagatgaggcagta
aatgactttgctaagtctttattaagtgttaaacgtgatttaacttattgcagtgtctgt
gggaatattactgaagatgacccctgcgagatatgtgcagatacaacgcgagaccgttca
tgtgtgctcgtagtagaagagcctaaagatgtgatggctttggaaaaaatgaaagaatac
caaggactttaccatgttttacacggagtgctttctccggtggaaggtacagggcctgaa
gatattaatattcctaacttgatcaagcgtttagaaaatgaagaaataaaagaagtaatt
attgctactaatgcttctacagaaggtgaagctactgcgatgtatctttcacgtctgatt
aagccagcggggattacagtcacacggcttgctcatggcttgtctgttggaagtgatatt
gagtatgctgatgaagtgactttatcaaaggcagtagaaggcagaacagaattataa

DBGET integrated database retrieval system