KEGG   Tetragenococcus halophilus: TEH_07080Help
Entry
TEH_07080         CDS       T01640                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
thl  Tetragenococcus halophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TEH_07080 (recR)
DNA repair and recombination proteins [BR:thl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TEH_07080 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
729642..730238
Genome map
AA seq 198 aa AA seqDB search
MQYPEPIARLIASYMNLPGIGQKTATRLAFYTIDMKDEAVNDFAKSLLSVKRDLTYCSVC
GNITEDDPCEICADTTRDRSCVLVVEEPKDVMALEKMKEYQGLYHVLHGVLSPVEGTGPE
DINIPNLIKRLENEEIKEVIIATNASTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEVTLSKAVEGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatccagaacctattgctcgtttgattgcaagttatatgaacttaccaggtatc
ggccaaaaaacagcgacacgtttagctttttataccattgatatgaaagatgaggcagta
aatgactttgctaagtctttattaagtgttaaacgtgatttaacttattgcagtgtctgt
gggaatattactgaagatgacccctgcgagatatgtgcagatacaacgcgagaccgttca
tgtgtgctcgtagtagaagagcctaaagatgtgatggctttggaaaaaatgaaagaatac
caaggactttaccatgttttacacggagtgctttctccggtggaaggtacagggcctgaa
gatattaatattcctaacttgatcaagcgtttagaaaatgaagaaataaaagaagtaatt
attgctactaatgcttctacagaaggtgaagctactgcgatgtatctttcacgtctgatt
aagccagcggggattacagtcacacggcttgctcatggcttgtctgttggaagtgatatt
gagtatgctgatgaagtgactttatcaaaggcagtagaaggcagaacagaattataa

DBGET integrated database retrieval system