KEGG   Tetragenococcus halophilus: TEH_07080Help
Entry
TEH_07080         CDS       T01640                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
thl  Tetragenococcus halophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:thl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
729642..730238
Genome map
AA seq 198 aa AA seqDB search
MQYPEPIARLIASYMNLPGIGQKTATRLAFYTIDMKDEAVNDFAKSLLSVKRDLTYCSVC
GNITEDDPCEICADTTRDRSCVLVVEEPKDVMALEKMKEYQGLYHVLHGVLSPVEGTGPE
DINIPNLIKRLENEEIKEVIIATNASTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEVTLSKAVEGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatccagaacctattgctcgtttgattgcaagttatatgaacttaccaggtatc
ggccaaaaaacagcgacacgtttagctttttataccattgatatgaaagatgaggcagta
aatgactttgctaagtctttattaagtgttaaacgtgatttaacttattgcagtgtctgt
gggaatattactgaagatgacccctgcgagatatgtgcagatacaacgcgagaccgttca
tgtgtgctcgtagtagaagagcctaaagatgtgatggctttggaaaaaatgaaagaatac
caaggactttaccatgttttacacggagtgctttctccggtggaaggtacagggcctgaa
gatattaatattcctaacttgatcaagcgtttagaaaatgaagaaataaaagaagtaatt
attgctactaatgcttctacagaaggtgaagctactgcgatgtatctttcacgtctgatt
aagccagcggggattacagtcacacggcttgctcatggcttgtctgttggaagtgatatt
gagtatgctgatgaagtgactttatcaaaggcagtagaaggcagaacagaattataa

DBGET integrated database retrieval system