KEGG   Tetragenococcus halophilus: TEH_08970Help
Entry
TEH_08970         CDS       T01640                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00010  Glycolysis / Gluconeogenesis
thl00030  Pentose phosphate pathway
thl00051  Fructose and mannose metabolism
thl00052  Galactose metabolism
thl00680  Methane metabolism
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01130  Biosynthesis of antibiotics
thl01200  Carbon metabolism
thl01230  Biosynthesis of amino acids
thl03018  RNA degradation
Module
thl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_08970 (pfk)
   00030 Pentose phosphate pathway
    TEH_08970 (pfk)
   00051 Fructose and mannose metabolism
    TEH_08970 (pfk)
   00052 Galactose metabolism
    TEH_08970 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TEH_08970 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TEH_08970 (pfk)
Enzymes [BR:thl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TEH_08970 (pfk)
Protein phosphatases and associated proteins [BR:thl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TEH_08970 (pfk)
Messenger RNA biogenesis [BR:thl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TEH_08970 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 11260960
NCBI-ProteinID: BAK94224
UniProt: G4L6Q0
Position
898605..899567
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAITRKAIFSGMEVYGINYGFAGLVAGDIRRLEIADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLNKFGIEGLVVIGGDGSYHGALALTRHGYPAV
GIPGTIDNDIPGTDFTIGFDTATNTILDSLDRIRDTATSHVRTFIIEVMGRDAGDIALWA
GVAGGADEIIIPEHDFHMDKVAKRIQEGRDRGKKHCLIVVAEGVMGANEFAEKLKDYGDF
HTRVSILGHVARGGSPSARDRVLASKFGGFAVELLQEGKGGRCVGLLDNKVVSSDIVDTL
ENGKHQPDLSLYDLNQELSF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattggaattttaaccagcggcggagacgcacctggtatgaatgcggcgatt
cgtgcgattacacgtaaagcgatttttagcggaatggaagtttacggaatcaattatggt
tttgctggattggtagctggagatatccgtcgtttagaaatagctgatgttggagataaa
attcaacgtggaggaaccttcctttattcagcacgttatcctgaattcgcgacagaagaa
ggacagttaaaaggtatagaacagttaaataaatttggcattgaaggcttagttgtcatc
ggtggcgatggctcttatcatggagcgcttgctttgacaagacacggttatccagcagtt
ggtattcctggtaccattgataatgatattcctggtaccgattttactattggttttgat
acagctactaatactatactagattcattggaccgtatcagagacacagcgacttctcat
gtacgcacatttattattgaagttatgggaagagatgcaggcgatattgctttatgggca
ggagtagctggaggcgctgacgagattattatccctgaacatgattttcatatggataaa
gttgcaaaacgtattcaagaaggtcgcgatcgtggcaaaaaacattgtttaattgttgta
gctgaaggtgtaatgggcgctaatgaatttgctgaaaaattaaaagactatggcgatttt
catacaagagtctctattcttggccacgttgcccgtggtggttcaccaagtgctagagat
cgtgtgttggctagtaagttcggtggttttgcagttgagcttttacaagaaggtaaaggt
ggtcgctgtgttggcttgcttgataataaggtcgtttcatcagatattgttgatacacta
gaaaatggcaagcatcaacctgatctttccctttatgatttgaaccaagaattgtcattc
tga

DBGET integrated database retrieval system