KEGG   Tetragenococcus halophilus: TEH_08970Help
Entry
TEH_08970         CDS       T01640                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEH_08970 (pfk)
   01230 Biosynthesis of amino acids
    TEH_08970 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_08970 (pfk)
   00030 Pentose phosphate pathway
    TEH_08970 (pfk)
   00051 Fructose and mannose metabolism
    TEH_08970 (pfk)
   00052 Galactose metabolism
    TEH_08970 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TEH_08970 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TEH_08970 (pfk)
Enzymes [BR:thl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TEH_08970 (pfk)
Protein phosphatases and associated proteins [BR:thl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TEH_08970 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898605..899567
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAITRKAIFSGMEVYGINYGFAGLVAGDIRRLEIADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLNKFGIEGLVVIGGDGSYHGALALTRHGYPAV
GIPGTIDNDIPGTDFTIGFDTATNTILDSLDRIRDTATSHVRTFIIEVMGRDAGDIALWA
GVAGGADEIIIPEHDFHMDKVAKRIQEGRDRGKKHCLIVVAEGVMGANEFAEKLKDYGDF
HTRVSILGHVARGGSPSARDRVLASKFGGFAVELLQEGKGGRCVGLLDNKVVSSDIVDTL
ENGKHQPDLSLYDLNQELSF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattggaattttaaccagcggcggagacgcacctggtatgaatgcggcgatt
cgtgcgattacacgtaaagcgatttttagcggaatggaagtttacggaatcaattatggt
tttgctggattggtagctggagatatccgtcgtttagaaatagctgatgttggagataaa
attcaacgtggaggaaccttcctttattcagcacgttatcctgaattcgcgacagaagaa
ggacagttaaaaggtatagaacagttaaataaatttggcattgaaggcttagttgtcatc
ggtggcgatggctcttatcatggagcgcttgctttgacaagacacggttatccagcagtt
ggtattcctggtaccattgataatgatattcctggtaccgattttactattggttttgat
acagctactaatactatactagattcattggaccgtatcagagacacagcgacttctcat
gtacgcacatttattattgaagttatgggaagagatgcaggcgatattgctttatgggca
ggagtagctggaggcgctgacgagattattatccctgaacatgattttcatatggataaa
gttgcaaaacgtattcaagaaggtcgcgatcgtggcaaaaaacattgtttaattgttgta
gctgaaggtgtaatgggcgctaatgaatttgctgaaaaattaaaagactatggcgatttt
catacaagagtctctattcttggccacgttgcccgtggtggttcaccaagtgctagagat
cgtgtgttggctagtaagttcggtggttttgcagttgagcttttacaagaaggtaaaggt
ggtcgctgtgttggcttgcttgataataaggtcgtttcatcagatattgttgatacacta
gaaaatggcaagcatcaacctgatctttccctttatgatttgaaccaagaattgtcattc
tga

DBGET integrated database retrieval system