KEGG   Tetragenococcus halophilus: TEH_09990Help
Entry
TEH_09990         CDS       T01640                                 

Definition
(RefSeq) putative triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEH_09990
   01230 Biosynthesis of amino acids
    TEH_09990
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_09990
   00051 Fructose and mannose metabolism
    TEH_09990
   00562 Inositol phosphate metabolism
    TEH_09990
Enzymes [BR:thl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TEH_09990
Exosome [BR:thl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TEH_09990
  Exosomal proteins of bladder cancer cells
   TEH_09990
  Exosomal proteins of melanoma cells
   TEH_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997657..998355
Genome map
AA seq 232 aa AA seqDB search
MELQAPFFTFNPKSYFYGKKLLELARKADTLAQKYPHLTILITAPYVDLANIASHTQHII
VTAQHMDGIAPGRGMGAVLPASIYQAGARAVFLNHAEHPLQLTELVQSMKKAKELGIKTI
VCANSLEEARSIALLKPDVLLCEPTELIGTGQTSDESYIQETNHAIKEIDPDIYILQAAG
ISTPEDVYRTLKLGADGTGCTSGITEADSPSQMLEEMIESVQRIYEERKDGK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagttacaagcaccgttttttacttttaatccgaagtcttatttttatggtaagaaa
ttattagaattagcacgaaaagctgataccttagcccaaaagtatccccatttaacgatt
cttatcactgcgccttatgttgatttagcaaatatcgcaagccatacgcaacatattatc
gttacagcacaacacatggatggaattgctccaggaagaggaatgggtgcagtattacca
gcgtctatttatcaagcaggggctcgagcagtttttttgaaccatgcagaacatcctttg
caattaacagagcttgttcaatcgatgaaaaaggccaaagaacttgggattaaaacaatt
gtatgcgctaactctttagaagaagctcgttcaattgctttacttaaaccagacgttttg
ctttgtgagcccactgaactcattggaacgggacaaacaagtgatgaaagttatatccaa
gaaacaaatcatgccataaaagagattgacccggatatctatattttacaagcagctggg
ataagtacccctgaagatgtgtatcgtacacttaaattgggcgcggatggtacgggatgt
accagtggaatcaccgaagcagattcgcctagtcaaatgttggaggaaatgattgaatca
gtgcaacgcatctatgaagaaagaaaggatggaaaataa

DBGET integrated database retrieval system