KEGG   Tetragenococcus halophilus: TEH_09990Help
Entry
TEH_09990         CDS       T01640                                 

Definition
putative triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:thl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:thl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:thl00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997657..998355
Genome map
AA seq 232 aa AA seqDB search
MELQAPFFTFNPKSYFYGKKLLELARKADTLAQKYPHLTILITAPYVDLANIASHTQHII
VTAQHMDGIAPGRGMGAVLPASIYQAGARAVFLNHAEHPLQLTELVQSMKKAKELGIKTI
VCANSLEEARSIALLKPDVLLCEPTELIGTGQTSDESYIQETNHAIKEIDPDIYILQAAG
ISTPEDVYRTLKLGADGTGCTSGITEADSPSQMLEEMIESVQRIYEERKDGK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagttacaagcaccgttttttacttttaatccgaagtcttatttttatggtaagaaa
ttattagaattagcacgaaaagctgataccttagcccaaaagtatccccatttaacgatt
cttatcactgcgccttatgttgatttagcaaatatcgcaagccatacgcaacatattatc
gttacagcacaacacatggatggaattgctccaggaagaggaatgggtgcagtattacca
gcgtctatttatcaagcaggggctcgagcagtttttttgaaccatgcagaacatcctttg
caattaacagagcttgttcaatcgatgaaaaaggccaaagaacttgggattaaaacaatt
gtatgcgctaactctttagaagaagctcgttcaattgctttacttaaaccagacgttttg
ctttgtgagcccactgaactcattggaacgggacaaacaagtgatgaaagttatatccaa
gaaacaaatcatgccataaaagagattgacccggatatctatattttacaagcagctggg
ataagtacccctgaagatgtgtatcgtacacttaaattgggcgcggatggtacgggatgt
accagtggaatcaccgaagcagattcgcctagtcaaatgttggaggaaatgattgaatca
gtgcaacgcatctatgaagaaagaaaggatggaaaataa

DBGET integrated database retrieval system