KEGG   Tetragenococcus halophilus: TEH_10190Help
Entry
TEH_10190         CDS       T01640                                 

Definition
(RefSeq) putative oxidoreductase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TEH_10190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_10190
  Lipid metabolism
   00071 Fatty acid degradation
    TEH_10190
  Amino acid metabolism
   00350 Tyrosine metabolism
    TEH_10190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TEH_10190
   00626 Naphthalene degradation
    TEH_10190
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TEH_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013357..1014358
Genome map
AA seq 333 aa AA seqDB search
MKAMGISHYKQEKLEELTLPMPEISANEVLVEIVAASINPVDLKIRDGKLKMLLSYDMPL
VLGNDFAGRIVKLGDKVTKFKVGDEVYGRPQKSKIGTFAEYIGIDQGDIALKPKNLTFEE
AASIPLVGLTSYQALHDIMQVKPGDKVLIQAGSGGIGTIAIQLAKLMGVYVATTASNRGK
DLVTRLGADQIINYHEENFAEVLSDYDDVFDTLGGQNLMDGFRILKPGGNIVTISGTPNA
RFGKEYGVGWFKTMLFSLASFKLTRLEKQYDVNYHFLFMKPSGEQLEILRDYIEDGKLEP
IVDRVFSFEQTQEAVEYSESGHAKGKIIIKIQE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgggaatttctcattataaacaagaaaaattagaagaattaactttacct
atgcctgaaatttcggctaatgaagtattagtagaaattgttgctgcaagtattaacccg
gttgatttgaaaattcgcgatggaaaactaaaaatgttgttaagctatgatatgccctta
gttttaggcaatgattttgccggacgaattgtaaaattaggcgataaggtaacaaaattc
aaggtcggtgatgaagtttacggtcgaccacaaaagtctaaaatcggcacatttgctgaa
tatatcggtattgaccaaggagatattgcattgaagcctaaaaatcttacttttgaagaa
gctgcatcgattcctttggttggcttgaccagttatcaagccctacacgatattatgcaa
gtaaaaccaggcgataaagtattaatccaagctggctctggtggcattggtacgattgcg
attcaattagctaaattaatgggcgtctatgtcgctacaacagcaagtaaccgaggcaag
gatttagtaactcgtctaggtgcagatcaaataattaactatcatgaagaaaattttgcg
gaagtcttaagtgattatgatgatgtctttgatactttaggtggtcaaaacttgatggat
ggttttagaatactaaaaccaggaggtaacatagtaacgatcagcggaacacccaatgct
cgttttggtaaagaatatggtgtcggttggtttaaaaccatgctgtttagcctcgcttca
tttaaattgacacgtttagaaaagcaatacgacgtgaactatcactttctattcatgaaa
ccaagtggtgaacaactagaaattttacgtgattatattgaagatgggaaattagaacct
attgtggatcgtgtattttcctttgaacaaacgcaagaagctgtagaatattcagagtct
ggacatgctaaaggaaaaatcataattaaaatacaagaataa

DBGET integrated database retrieval system