KEGG   Tetragenococcus halophilus: TEH_10190Help
Entry
TEH_10190         CDS       T01640                                 

Definition
putative oxidoreductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TEH_10190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_10190
  Lipid metabolism
   00071 Fatty acid degradation
    TEH_10190
  Amino acid metabolism
   00350 Tyrosine metabolism
    TEH_10190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TEH_10190
   00626 Naphthalene degradation
    TEH_10190
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TEH_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013357..1014358
Genome map
AA seq 333 aa AA seqDB search
MKAMGISHYKQEKLEELTLPMPEISANEVLVEIVAASINPVDLKIRDGKLKMLLSYDMPL
VLGNDFAGRIVKLGDKVTKFKVGDEVYGRPQKSKIGTFAEYIGIDQGDIALKPKNLTFEE
AASIPLVGLTSYQALHDIMQVKPGDKVLIQAGSGGIGTIAIQLAKLMGVYVATTASNRGK
DLVTRLGADQIINYHEENFAEVLSDYDDVFDTLGGQNLMDGFRILKPGGNIVTISGTPNA
RFGKEYGVGWFKTMLFSLASFKLTRLEKQYDVNYHFLFMKPSGEQLEILRDYIEDGKLEP
IVDRVFSFEQTQEAVEYSESGHAKGKIIIKIQE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgggaatttctcattataaacaagaaaaattagaagaattaactttacct
atgcctgaaatttcggctaatgaagtattagtagaaattgttgctgcaagtattaacccg
gttgatttgaaaattcgcgatggaaaactaaaaatgttgttaagctatgatatgccctta
gttttaggcaatgattttgccggacgaattgtaaaattaggcgataaggtaacaaaattc
aaggtcggtgatgaagtttacggtcgaccacaaaagtctaaaatcggcacatttgctgaa
tatatcggtattgaccaaggagatattgcattgaagcctaaaaatcttacttttgaagaa
gctgcatcgattcctttggttggcttgaccagttatcaagccctacacgatattatgcaa
gtaaaaccaggcgataaagtattaatccaagctggctctggtggcattggtacgattgcg
attcaattagctaaattaatgggcgtctatgtcgctacaacagcaagtaaccgaggcaag
gatttagtaactcgtctaggtgcagatcaaataattaactatcatgaagaaaattttgcg
gaagtcttaagtgattatgatgatgtctttgatactttaggtggtcaaaacttgatggat
ggttttagaatactaaaaccaggaggtaacatagtaacgatcagcggaacacccaatgct
cgttttggtaaagaatatggtgtcggttggtttaaaaccatgctgtttagcctcgcttca
tttaaattgacacgtttagaaaagcaatacgacgtgaactatcactttctattcatgaaa
ccaagtggtgaacaactagaaattttacgtgattatattgaagatgggaaattagaacct
attgtggatcgtgtattttcctttgaacaaacgcaagaagctgtagaatattcagagtct
ggacatgctaaaggaaaaatcataattaaaatacaagaataa

DBGET integrated database retrieval system