KEGG   Tetragenococcus halophilus: TEH_15040Help
Entry
TEH_15040         CDS       T01640                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase/DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
thl  Tetragenococcus halophilus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:thl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1518107..1518955)
Genome map
AA seq 282 aa AA seqDB search
MPELPEVETVRKGLVTLVQDKTVAEVIVRWPKIIESPAVDTFCQKLIGQVINDIARRGKF
LIFEFTDFDLISHLRMEGKYEYTPKNTEAPVDKHTHVIFKFTDGSQLSYHDVRKFGRMAL
VEKGQYPFYKGIKQLGPEPVEEEFSLQAFEKKLQHSSSLIKPLLLNQKVVAGLGNIYADE
VLWLAKIHPQQPARTLTKKEAESLHQAIIAILAKAVRAGGTTIRSYKNALGEAGFFQVSL
NVYGKTGEPCPRCETPIKKIKVAQRGTHFCPHCQKLKRRKLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaattgccagaagtagaaacagttagaaaagggctagttacccttgtccaagac
aaaactgttgcagaagttattgttagatggcctaaaatcattgaatcaccggcagttgat
acattttgccaaaaactaatcggacaagttatcaatgatattgcgcgtagagggaaattt
ttaatttttgaatttactgattttgatttgatttctcatttacgtatggaaggtaagtac
gaatatacaccaaagaatactgaagctccggttgataaacatactcatgtgatatttaaa
tttacagatgggagtcaactgtcctatcatgatgtaagaaaatttggacgcatggcttta
gtagaaaaaggacaatatccgttttataaagggattaagcaattgggaccagaaccagta
gaagaagaattttcattgcaagcatttgagaaaaaactacaacattcttcttctttaata
aaacctctgttacttaatcaaaaagttgtagcaggtctaggaaatatttatgcggatgaa
gtattatggctagctaaaattcatcctcaacagccagctcgcactttaacaaaaaaagaa
gcagaaagtttacaccaggcaattattgctattttagctaaagcagttagagcgggtggg
acaaccattcgttcttataaaaatgctttaggtgaggcaggattttttcaagtgagttta
aatgtttatggtaaaacaggtgaaccctgtcctagatgtgaaacgcctattaaaaaaatt
aaagtggcgcaaagaggcacacatttttgtccgcattgtcagaaattaaagaggaggaag
ctgtcatga

DBGET integrated database retrieval system