KEGG   Tetragenococcus halophilus: TEH_15470Help
Entry
TEH_15470         CDS       T01640                                 

Definition
(GenBank) putative alanine aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00220  Arginine biosynthesis
thl00250  Alanine, aspartate and glutamate metabolism
thl00290  Valine, leucine and isoleucine biosynthesis
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01130  Biosynthesis of antibiotics
thl01210  2-Oxocarboxylic acid metabolism
thl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TEH_15470
   00290 Valine, leucine and isoleucine biosynthesis
    TEH_15470
   00220 Arginine biosynthesis
    TEH_15470
Enzymes [BR:thl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TEH_15470
    2.6.1.66  valine---pyruvate transaminase
     TEH_15470
Amino acid related enzymes [BR:thl01007]
 Aminotransferase (transaminase)
  Class I
   TEH_15470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 DUF4852 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 11260013
NCBI-ProteinID: BAK94874
UniProt: G4L8K0
Position
complement(1564513..1565730)
Genome map
AA seq 405 aa AA seqDB search
MRDFEKSGKLEGVSYDVRGPVVEEADRMQEEGVSILKLNTGNPATFGFEAPNEVVRDLIM
NVRESEGYSDSKGVFSARKAIEQYCQLRDFPEVSINDIYTGNGVSELITMSMQGLCNNGD
EVLVPMPDYPLWTASVSLAGGKPVHYICDEASEWNPDIDDIRSKVTSKTKAIVLINPNNP
TGAVYPKEVLEGVVQIAREFDLIIFSDEIYDRLVMDEYKHIPIATLAPDRPIVTFSGLSK
SHRVAGFRVGWMVISGDKSHIKDYIEGLNMLSSMRLCSNVLSQQIIQTALGGYQSVDELL
LPGGRIYEQREYIYNAINSIEGLSAVKPKAAFYIFPKIDTKRFNILDDEQFVLDFLHEYH
VLLVHGGGFNWQQPDHFRIVYLPNLDDLKLTTEKMKEFLATYKQK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttgaaaaatccggtaaacttgaaggtgtcagttacgatgtaagaggaccg
gtggtagaagaagcggatcgtatgcaagaagaaggggttagtattttaaaattaaatact
ggtaatcctgcgacttttggatttgaagctccgaatgaagtggttcgcgacttaattatg
aatgtacgagaatcagaagggtattctgattcaaagggtgttttttcagcaagaaaagcg
attgaacagtactgtcaattacgtgattttcctgaagtttcaattaatgacatctatact
ggtaacggtgttagtgaactgattacaatgtcaatgcaagggctttgtaataatggagac
gaagtacttgtacctatgccagattatcctttgtggacagcttcagtatctttagcaggt
ggaaagcccgttcattatatctgtgatgaggccagtgaatggaatccggatatagatgat
attcgttctaaagtaactagtaaaacaaaagcgattgttttgatcaatcctaacaatcca
acaggagcagtttatcctaaggaagttttagaaggcgttgttcaaatcgctagggaattt
gatctgattatcttttctgatgaaatttatgatcgtttagtcatggatgaatataaacat
attcccattgcaactttagcaccggatcgtccgattgtgacctttagtggtttgtcgaaa
tctcatcgtgtagctggttttcgtgtaggttggatggtaatcagtggggacaaatctcat
atcaaagactatattgaaggcttaaatatgctttcgtctatgcgtttatgttcaaatgtt
ttatcacaacaaattatccaaacagcattaggcggatatcaaagtgttgatgaactacta
cttcctggtgggcgaatttatgagcaacgagagtatatttataatgcgattaatagtata
gaaggcctttcagccgttaagcctaaagcagctttttatatttttcctaaaattgatacc
aagcgttttaatatcttggatgatgaacagtttgtattggactttttacacgaatatcat
gttttattagttcatggcggtggttttaattggcaacagcctgatcatttccgaattgtt
tatctgcctaatttagatgatttaaaattaacgacagagaaaatgaaagagttcttggct
acttataagcaaaaataa

DBGET integrated database retrieval system