KEGG   Tetragenococcus halophilus: TEH_15540Help
Entry
TEH_15540         CDS       T01640                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00500  Starch and sucrose metabolism
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TEH_15540 (glgB)
Enzymes [BR:thl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TEH_15540 (glgB)
Exosome [BR:thl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TEH_15540 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 11261041
NCBI-ProteinID: BAK94881
UniProt: G4L8K7
Position
complement(1572295..1574181)
Genome map
AA seq 628 aa AA seqDB search
MLESSKEVLEAEQRFLTGENFYVQHFLGVHKNENGYVFRVWAPHAQQVYLIGDFNDWDES
LPMEKREKSGVWELATSLAEEGQLYKFLVQQANGRKIMKIDPFAVRFEERPGTAAVIYTI
PEKKWHDNLWRGRQKKTQTLKRPMNIYEVHASSWKHDESGQPYTFKELEEELIPYVKEMD
YTHIEFLPLMEHLLGASWGYQLTGFFALSSYYGTPVEFRDFVDSCHKNNIGVFVDWVPAH
FCVNEDTLPYYDGTPTFEYEDPNRAHNIRWGTICFDLGKPQVQSFLISSALFWLDVYHLD
GMRVDAVTSMLYLDYDEGPWQPNHEGGNRNFEGFYFLQKLNAVIKLAFPQTVMMAEESSS
ETQITGMIESGALGFDYKWNMGWMNDVLRFYEMDPVFRKDNFHLLTFSFMYMMNEHYILP
FSHDEVVHGKKSLMHKMWGDRYKQFAQLRNMYTFMMTHPGKKILFMGSEWGQFLEWKYNE
GLEWVDLEDELNNKMQHFTAKLNSLYKDERSLWELEDTAETVELIDADNTAESVLTFIRK
SKTKRDFLIIALNLTPVERQDFAIGVPYPGSYQEVLNTEKIEFGGTWTKNNSRCQSIDQP
FKQFNQQIQTVLPALGALIIKPEEIQMK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatcaagtaaagaagtcttagaagctgaacaacgttttttaacgggagaaaac
ttttatgttcaacattttttaggtgttcacaaaaatgaaaacggatacgtttttcgagta
tgggcgcctcatgcccagcaagtatatttgataggagattttaatgactgggatgagtct
ttgcccatggaaaaaagagaaaaatcaggcgtatgggagcttgcaacttccttggcggaa
gaaggacaattgtataaatttttagttcaacaagcaaatggtcgtaaaattatgaaaatt
gacccttttgcggttcgttttgaagaaagacctggaacagcagcagtcatttatactatt
cctgaaaaaaaatggcatgataatttatggcgtggtcgtcaaaaaaagacacaaacattg
aaacgccctatgaatatttacgaagttcatgctagctcttggaagcatgatgaaagtggg
cagccttatacttttaaagagttagaagaagagctcattccttatgttaaggaaatggac
tatacacatattgaatttctcccgttgatggaacaccttcttggcgcctcttggggttac
caattaacaggtttttttgcattatcttcttattatggtacaccagttgagtttcgtgat
tttgtagattcttgtcataagaataatattggtgtatttgtggattgggtgcctgctcat
ttttgtgttaatgaggatacattaccttattatgatggaacaccaacttttgagtatgaa
gatccaaaccgagcgcataacattcgttggggaaccatttgttttgatcttggtaaacca
caggtacagagtttcttgatttcaagtgcattattttggctagatgtttaccatcttgat
ggtatgcgtgtggatgccgttactagcatgttgtatttagattatgacgaaggtccatgg
cagcctaatcatgaaggaggcaatcgaaattttgaaggcttctattttctacaaaaactt
aatgctgtcattaaacttgcctttccacaaactgttatgatggctgaagaaagcagctcg
gaaacccaaattaccggtatgattgaaagtggcgcattgggctttgattataaatggaat
atgggttggatgaatgatgtactacgtttttatgaaatggatcctgttttccgtaaagat
aatttccatttattgaccttttctttcatgtatatgatgaatgaacattacattcttcct
ttttctcatgatgaagttgttcatggtaaaaaaagtttaatgcataaaatgtggggcgat
cgttataaacaatttgctcaattacgaaatatgtatacttttatgatgacacatccgggc
aaaaaaatcctctttatgggaagtgaatggggtcagtttctcgagtggaaatataatgaa
ggtttggaatgggtggatctggaagatgaactgaataataaaatgcaacattttactgct
aaactaaattccttgtataaagatgagcgtagcctatgggaattagaggatacagcggaa
actgtagaattaattgatgctgataataccgcagagagtgtattgacttttatacgtaaa
tcaaaaaccaaaagggattttcttattatagcgctaaatctaacgcctgtagaaagacaa
gattttgcgatcggtgttccttatccaggaagttatcaagaagtattgaatacagaaaaa
attgaatttggtggtacttggactaaaaataatagtcgctgtcaaagtattgatcagcca
tttaaacagtttaatcagcagatacagacggttttacccgctttaggtgcacttattatt
aaacctgaggaaattcaaatgaaataa

DBGET integrated database retrieval system