KEGG   Tetragenococcus halophilus: TEH_16530Help
Entry
TEH_16530         CDS       T01640                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TEH_16530 (glpO)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     TEH_16530 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1683963..1685783)
Genome map
AA seq 606 aa AA seqDB search
MVFSYKTRNEEIQKVQDEELDLLVIGGGISGAGVAVQAAASGMKTALVEMQDFAEGTSSR
STKLVHGGIRYLKTFDVEVVNDTVKERANVQHIAPHIPKPDPMLLPIYDEAGATFNMFSA
KVAMDLYDRLAGVTGKFANYTLNKSEVLERQPQLEKEGLQGGGVYLDFRNNDSRLVIENI
KKAHEDGARVLNKVKVVKITHDQQGMVNGADVQDVISGRNFHINAKVVINTSGPWTDEVR
DLDKKDDLSDQMRPTKGVHLVVDKEKLNVPQPTYFDTGENDGRMIFVVPREDKTYFGTTD
TDYHGDLKHPKVTQEDVDYLLRIVNRRYPDAKIGLDDIEASWAGLRPLITANGGSDYNGG
GGSEKLSDESFNKVVNTTKEYLEDDAKRDDVEKAIQEADSAQDSGEVDPSQISRGSSLEE
ASDGLVTLSGGKITDYRLMAEGALKKINEKLDSQFDLIDSKEYPVSGGDIDPDNVDEEIK
KLAKQAQDKGLNEKDALYLANLYGSNLPTVLTYDEPIKGLSQRDSFSLNYALNEELVLTP
VDYFLRRTNFILFIRDELDALEQPVLDKMAEFYQWSDEEKANYQKELAEVVAESDLKELK
EDEYRE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcatataagacaagaaatgaagaaatacaaaaagttcaagatgaagaacta
gacttacttgtaattggaggagggattagcggagctggcgttgctgtacaagccgccgct
tccggtatgaaaaccgcattagttgaaatgcaagattttgctgaaggaacttcttctcgt
tcaacaaaattagtccatggtggtattcgttatttaaaaacatttgatgtagaagttgtt
aacgatacggtgaaagaacgtgcaaatgtacaacatatcgcaccgcatattccaaaacca
gaccccatgcttttgcctatttatgatgaagctggcgcaacatttaatatgttttcagca
aaagtagcgatggatttatatgatcgtttggcaggcgttaccggcaaatttgctaattat
accttaaataagtcagaagtgttagaaagacaacctcaattagaaaaagaaggtttgcaa
ggtggcggtgtttatcttgattttcgcaataatgattcacgcttagtgattgaaaacatc
aaaaaagcacatgaagatggtgctcgagtattaaataaagtcaaagttgttaaaattaca
catgatcaacaaggtatggtcaatggcgctgatgttcaagatgtcattagcggtaggaat
ttccatattaatgctaaagttgtgatcaatacttctggaccatggacagatgaagtacgt
gatttggacaaaaaagatgacttatctgaccaaatgcgtcctacaaaaggtgttcattta
gttgtggataaagaaaaattaaatgttccacaaccaacttattttgatacaggtgaaaac
gatggtcgtatgatttttgttgttcccagagaggacaaaacctactttggaacaacagat
accgattatcatggtgatttaaaacatccaaaagttacacaagaagatgtcgactacttg
ttaagaattgttaaccgtcgttatcctgatgctaaaattggcttagacgatatcgaagct
agttgggcagggctacgtccattgatcactgcaaatggcggttctgattataatggtggt
ggcggcagcgaaaaactttctgatgaaagtttcaataaagtagtaaacaccacaaaagaa
tatttagaagacgatgctaaaagagacgatgtcgaaaaagcgatccaagaagcagatagt
gcacaggatagtggagaagtcgatccatcacaaatttctcgtggaagcagcttggaagaa
gctagcgacggtttagttaccctttcaggtggtaaaattacagactatcgtttgatggca
gaaggcgctttgaagaaaattaacgagaaattagatagtcaatttgacttaattgactct
aaagaatatccagtttctggcggagatattgatcctgataatgttgatgaagaaattaaa
aaattagctaaacaggcacaagataaaggattaaatgaaaaagacgctctttatttggca
aatctttatggatcaaatttaccaacagtattgacttatgatgaaccaatcaaagggtta
agccaacgtgatagtttttcattaaattatgcgttaaatgaagaactcgtgctaactcct
gttgattacttcttacgtcgtacaaactttatcttatttattcgcgatgagttagatgct
ttagaacaaccagtacttgataaaatggctgaattttatcaatggagtgatgaagaaaaa
gccaactatcaaaaagaattagcagaagttgtggcagaatcagatttgaaagagttgaag
gaggacgaataccgtgagtga

DBGET integrated database retrieval system