KEGG   Tetragenococcus halophilus: TEH_16530Help
Entry
TEH_16530         CDS       T01640                                 

Gene name
glpO
Definition
(GenBank) alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00564  Glycerophospholipid metabolism
thl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TEH_16530 (glpO)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     TEH_16530 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA FAD_oxidored NAD_binding_8 Pyr_redox 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 11260085
NCBI-ProteinID: BAK94980
UniProt: G4L8V6
Position
complement(1683963..1685783)
Genome map
AA seq 606 aa AA seqDB search
MVFSYKTRNEEIQKVQDEELDLLVIGGGISGAGVAVQAAASGMKTALVEMQDFAEGTSSR
STKLVHGGIRYLKTFDVEVVNDTVKERANVQHIAPHIPKPDPMLLPIYDEAGATFNMFSA
KVAMDLYDRLAGVTGKFANYTLNKSEVLERQPQLEKEGLQGGGVYLDFRNNDSRLVIENI
KKAHEDGARVLNKVKVVKITHDQQGMVNGADVQDVISGRNFHINAKVVINTSGPWTDEVR
DLDKKDDLSDQMRPTKGVHLVVDKEKLNVPQPTYFDTGENDGRMIFVVPREDKTYFGTTD
TDYHGDLKHPKVTQEDVDYLLRIVNRRYPDAKIGLDDIEASWAGLRPLITANGGSDYNGG
GGSEKLSDESFNKVVNTTKEYLEDDAKRDDVEKAIQEADSAQDSGEVDPSQISRGSSLEE
ASDGLVTLSGGKITDYRLMAEGALKKINEKLDSQFDLIDSKEYPVSGGDIDPDNVDEEIK
KLAKQAQDKGLNEKDALYLANLYGSNLPTVLTYDEPIKGLSQRDSFSLNYALNEELVLTP
VDYFLRRTNFILFIRDELDALEQPVLDKMAEFYQWSDEEKANYQKELAEVVAESDLKELK
EDEYRE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcatataagacaagaaatgaagaaatacaaaaagttcaagatgaagaacta
gacttacttgtaattggaggagggattagcggagctggcgttgctgtacaagccgccgct
tccggtatgaaaaccgcattagttgaaatgcaagattttgctgaaggaacttcttctcgt
tcaacaaaattagtccatggtggtattcgttatttaaaaacatttgatgtagaagttgtt
aacgatacggtgaaagaacgtgcaaatgtacaacatatcgcaccgcatattccaaaacca
gaccccatgcttttgcctatttatgatgaagctggcgcaacatttaatatgttttcagca
aaagtagcgatggatttatatgatcgtttggcaggcgttaccggcaaatttgctaattat
accttaaataagtcagaagtgttagaaagacaacctcaattagaaaaagaaggtttgcaa
ggtggcggtgtttatcttgattttcgcaataatgattcacgcttagtgattgaaaacatc
aaaaaagcacatgaagatggtgctcgagtattaaataaagtcaaagttgttaaaattaca
catgatcaacaaggtatggtcaatggcgctgatgttcaagatgtcattagcggtaggaat
ttccatattaatgctaaagttgtgatcaatacttctggaccatggacagatgaagtacgt
gatttggacaaaaaagatgacttatctgaccaaatgcgtcctacaaaaggtgttcattta
gttgtggataaagaaaaattaaatgttccacaaccaacttattttgatacaggtgaaaac
gatggtcgtatgatttttgttgttcccagagaggacaaaacctactttggaacaacagat
accgattatcatggtgatttaaaacatccaaaagttacacaagaagatgtcgactacttg
ttaagaattgttaaccgtcgttatcctgatgctaaaattggcttagacgatatcgaagct
agttgggcagggctacgtccattgatcactgcaaatggcggttctgattataatggtggt
ggcggcagcgaaaaactttctgatgaaagtttcaataaagtagtaaacaccacaaaagaa
tatttagaagacgatgctaaaagagacgatgtcgaaaaagcgatccaagaagcagatagt
gcacaggatagtggagaagtcgatccatcacaaatttctcgtggaagcagcttggaagaa
gctagcgacggtttagttaccctttcaggtggtaaaattacagactatcgtttgatggca
gaaggcgctttgaagaaaattaacgagaaattagatagtcaatttgacttaattgactct
aaagaatatccagtttctggcggagatattgatcctgataatgttgatgaagaaattaaa
aaattagctaaacaggcacaagataaaggattaaatgaaaaagacgctctttatttggca
aatctttatggatcaaatttaccaacagtattgacttatgatgaaccaatcaaagggtta
agccaacgtgatagtttttcattaaattatgcgttaaatgaagaactcgtgctaactcct
gttgattacttcttacgtcgtacaaactttatcttatttattcgcgatgagttagatgct
ttagaacaaccagtacttgataaaatggctgaattttatcaatggagtgatgaagaaaaa
gccaactatcaaaaagaattagcagaagttgtggcagaatcagatttgaaagagttgaag
gaggacgaataccgtgagtga

DBGET integrated database retrieval system