KEGG   Tetragenococcus halophilus: TEH_16540Help
Entry
TEH_16540         CDS       T01640                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:thl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685787..1687304)
Genome map
AA seq 505 aa AA seqDB search
MAEKKYVMAIDEGTTSARAILFDKNANEIGSSQKEFTQYFPDSGWVEHNANEIWNAVQAV
VAGALIESGIHPSEVASVGITNQRETAVIWDKNTGLPIYHAVVWQSRQSSDIAEQLINDG
YKDFIHEKTGLIIDPYFSATKIRWILDHVEGAQEKAENGDLLFGTIDTWLVWKLTSGNVH
VTDYSNASRTMLYNIHNLEWDQEILDLLNIPKAMLPEVKSNSEVYGYTETYHFFGSEVPI
AGMAGDQQSALFGQMAFEPGMVKNTYGTGSFIVMNIGEEPQLSENDLLTTIGYGINGKIY
YALEGSIFVSGSAIQWLRDEMNMVETAPESEEISKRASDDDYVYVVPAFTGLGAPYWDSG
ARGAVFGLTRATSRADFVKATLQSIAYQSKDVIDTMNKDTDTDIQLLRVDGGAANNDMLM
QFQSDILNIEVERAANLETTALGAAYLAGLAVGFWKDMEELKGLKEEGKTFKPEMDDEKR
EDLYAGWQEAVEATRVFKHRARKEG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaaaaatatgttatggcgatagatgaaggaacaacaagtgctagagcgatt
ttatttgataaaaatgccaatgaaattggcagttcgcagaaagaattcacgcagtatttc
ccggattctggttgggttgaacacaatgccaatgaaatttggaatgctgtgcaagcggtt
gtagctggcgcattaatcgaatcagggattcatcctagtgaagttgccagtgtggggatt
actaaccaacgtgaaacagcagttatttgggataaaaatacaggccttccaatttatcat
gctgttgtatggcaatcacgacaatcatcagatattgctgaacaattaatcaacgatggc
tataaagactttatccatgaaaaaacaggattaattattgacccttacttttctgctact
aaaattcgttggatcttagatcatgtagaaggtgcgcaagaaaaagctgaaaacggcgat
ttattgtttggtacaatcgatacttggttggtttggaaattaaccagcggaaatgtccat
gtaacagattattcaaacgctagtcgtacgatgttatataacattcacaacttagaatgg
gaccaagaaattttagatctattaaatattcctaaggcgatgctgccagaagtaaaaagt
aactcagaagtttatggctatactgaaacttatcatttctttggtagtgaagttccgatt
gctggaatggcaggggaccaacaatcagcgttgtttggtcaaatggcttttgaacctggt
atggttaaaaacacctatggtactgggtcatttatcgttatgaacattggagaagaacct
caattatctgaaaatgatttattaacaaccattgggtatggtattaatggcaaaatttat
tatgctttagaagggagtatctttgtttcaggttctgcgattcaatggctacgtgatgaa
atgaatatggtagaaacggcacctgaatcagaggaaatttcaaaaagagctagcgatgac
gattatgtttacgtagttccagcctttaccggtttgggcgcgccttattgggattctggc
gctcgtggtgcagtatttggtctgacacgtgcgacgagtcgagcagactttgttaaagca
acactacaatcgatcgcttatcaatctaaagacgttatcgataccatgaataaagataca
gatactgatattcaacttttgcgagtagacggtggtgctgctaacaacgatatgttgatg
caatttcaatcagatattttaaatatcgaagtagaacgtgctgctaatcttgaaacaact
gcgcttggtgctgcttatctagctggtttagctgttggtttctggaaagatatggaagag
ttgaaaggcttgaaagaagaagggaagacatttaaaccagaaatggatgatgaaaaacgc
gaagacctttatgcaggatggcaagaagccgttgaagcaacccgagtatttaaacatcgt
gcaaggaaagaaggataa

DBGET integrated database retrieval system