KEGG   Tetragenococcus halophilus: TEH_16630Help
Entry
TEH_16630         CDS       T01640                                 

Definition
putative oxidoreductase
Orthology
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
thl  Tetragenococcus halophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694649..1695530)
Genome map
AA seq 293 aa AA seqDB search
MNFQVLVIKTKYIGVSFADIYRRRGDYHIEDHSPPYINGYEGVGEVVKIGKNIKSCSIGE
DILFVDVPFANAELVSVPKENIIKIPKNMNIKLAASIGLQGLTAEFLANDLGQNVRGDKA
FIYGISGGVGQILSQILGADGVDVYGLTSSIEKQETALKQGAREVFLKEEEWFNDVQNSF
DTVYDGVGITVQQSIDLTKNRGKVVLFGMAGGTPPQVNLIELLTKSKSILTGDLWDYLTS
YEEREERSKRLFQYFVDGQITISEPTIFRLRNGKDAHEFLEAGKNIGKVLLTP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaactttcaagttttagttattaaaacaaaatatattggagtaagttttgcggatatt
tatagaagaagaggcgattatcacatagaggatcattctcctccatatatcaatggttat
gaaggcgttggagaagttgttaaaataggaaaaaatattaaaagttgctctataggggaa
gatattttgtttgtggatgttcctttcgctaatgcagaactggtatcagtaccaaaggaa
aatattataaaaatacccaaaaatatgaatataaagctggcagctagtataggtctgcaa
ggtttaactgccgaatttttagccaatgatttggggcaaaatgtgagaggagataaagcc
tttatctacgggattagcggtggagttggtcaaattctatctcaaatattgggagcagac
ggtgttgatgtctacgggcttacttcttcaatagaaaaacaagaaactgcattgaagcaa
ggggcaagggaagtatttttaaaagaagaggaatggtttaacgatgttcaaaattccttt
gatactgtttatgatggtgtaggcattactgttcagcagagtattgatttgactaaaaat
agaggtaaagttgttcttttcggtatggcagggggtacaccgcctcaagttaatttaatt
gaactacttacaaaatcaaaaagtatcttaactggagacttatgggattatttgacaagc
tacgaagaaagagaagaaagaagcaaacgattatttcaatattttgtagatggtcaaatt
accattagtgaaccaactatttttagattaagaaacggcaaagatgctcatgaattttta
gaagctggaaagaatattggcaaggttttattaactccttag

DBGET integrated database retrieval system