KEGG   Tetragenococcus halophilus: TEH_17210Help
Entry
TEH_17210         CDS       T01640                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
thl  Tetragenococcus halophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TEH_17210 (galU)
   00052 Galactose metabolism
    TEH_17210 (galU)
   00500 Starch and sucrose metabolism
    TEH_17210 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TEH_17210 (galU)
Enzymes [BR:thl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TEH_17210 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1753945..1754871)
Genome map
AA seq 308 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALNSGIEDILIVTGKAK
RPIEDHFDANLELEMSLKEKNKTDLLKLVEETTDVNLHFIRQSHPRGLGHAVLQAKAFVG
NEPFVVMLGDDLMQGKVPLSKQLMEDYEKTHTSTIAVMKVPHEDTSKYGIINPDGQVEDG
LYNVNSFVEKPEPEVAPSDLAIIGRYLLTPEIFSILENLAPGAGDEIQLTDAIDILNKTQ
RVFAREFRGKRFDVGDKFGFMQTSIEYGLAHPQIKDDLTDYIIKLGNELSKKRQLTETKT
RKTDTKEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagtgatcccagcagcaggtttaggtacccgctttttgccagcg
actaaggcgatggctaaagagatgcttcctatcgttgataaaccaaccatacaatttatt
gtggaagaagcattgaattcagggattgaagatattttaatcgttacgggtaaagctaaa
cgacctatcgaagaccattttgacgctaatttagagttggaaatgagtttaaaagaaaaa
aataaaacagatttattaaaattagttgaagaaacaactgatgttaaccttcattttatt
cgtcaatctcatccaagaggactgggtcatgctgttttacaagcaaaagcttttgtgggt
aacgaaccatttgtggtgatgttaggcgatgatctaatgcaaggaaaagtaccgctaagt
aagcaattgatggaagactatgagaaaacacatacttctacaattgctgtaatgaaagtt
cctcatgaggatacgtctaaatatgggattatcaatccggacggtcaagtagaagatggc
ttatataatgtaaacagctttgtggaaaaacctgaaccggaagtggcaccgagtgatttg
gcgattattggccgctatctacttacaccagagattttttccattttggaaaatttagcg
ccaggtgccggtgatgagatccaattgacagatgctattgatattttaaataaaacgcag
cgtgtgtttgctcgtgaatttagaggtaaacgatttgatgtaggtgataaattcggtttt
atgcaaacaagtattgagtatgggcttgctcatcctcaaatcaaagatgatttgacggat
tatattatcaaactggggaatgaattaagtaaaaaaaggcaattgactgaaacaaaaact
agaaaaacagatacaaaagaaaaataa

DBGET integrated database retrieval system