KEGG   Tetragenococcus halophilus: TEH_17700Help
Entry
TEH_17700         CDS       T01640                                 

Definition
putative carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
thl  Tetragenococcus halophilus
Brite
Enzymes [BR:thl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TEH_17700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1803588..1804343)
Genome map
AA seq 251 aa AA seqDB search
MQMNLPKPLLEEHGKRAVIFLHAYSGSPNDVRMLCRFLEKANYTVYAPMFKGHGTLDPQD
ILDQEVDNWAQDTRTAIDYLKNKGYKQLAVFGLSMGGIMSMDALTKNDSAIIGGGSFCSP
IFKTETNVPENFYLYAKKVLNYAGLSQEKIKKKLPEIADGAKEQLKGIESFSESVSKKVS
AIKVPVFLAQSGQDQMIDASTVFKTAQALEQSKMTLQWYPQSDHVVTVGPERKAFEKDVL
AYLESLPWNEE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgaatttacctaaaccattactagaagaacatgggaaaagagcggttattttt
ttacatgcttactctggaagtcctaatgatgttcgtatgctttgtcgttttttagaaaaa
gcaaactacacagtttatgcgccaatgtttaaaggtcatggaacattggacccgcaagat
attttggaccaagaagttgataattgggcacaagatacccgaactgctattgattatttg
aaaaataaaggctataaacagcttgctgtatttggattgtccatgggtggtatcatgtca
atggatgcattaacgaaaaatgattctgcgattattggtggagggagtttttgttctcca
atatttaaaacagagacaaatgtgccagaaaacttttacctttacgcaaaaaaagtttta
aattatgcggggttatcgcaagaaaaaatcaaaaaaaagctgccagaaatcgcagatggt
gcaaaagaacaattaaaaggaatagagagcttttcagaaagtgtcagtaaaaaagtgagc
gcgattaaagttccagtatttttggctcaatcaggtcaggatcagatgatcgatgcttcg
acagtttttaaaactgcgcaagctttggaacaaagcaaaatgactttacaatggtatcca
caaagtgatcatgtggtcactgtgggtcctgaaagaaaagcatttgaaaaagatgtgctt
gcttatttggaaagcttaccctggaatgaggaatga

DBGET integrated database retrieval system