KEGG   Tetragenococcus halophilus: TEH_19780Help
Entry
TEH_19780         CDS       T01640                                 

Gene name
aga
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
thl  Tetragenococcus halophilus
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:thl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:thl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1979882..1982086)
Genome map
AA seq 734 aa AA seqDB search
MSKTNVIFHQEEKVFHLNNGKVSYLIQIEEDGVVSHLYFGKSFESYSNHKKYPRRDRGFS
GNVPGNSERAYSKDTLPQEFSSHGSMDYRIPSSIIRRESGSNLHDFRYFDYRIEDGKPEL
KGLPQVYTESDEEAKTLVLTLKDRDQEIYVDLIYTIYSDRPTITRSTKVRNLTANSISIE
KIASMQMDLTNSGIYDEVISLPGAHVQERQLQREKINAGIKTFESRRGTTSHQMNSFIAL
VNHDTNEFSGPAIGLNFVYSGNHSFEIEKDQIDQLRVLIGINDYNFSWQLNSGESFQTPE
VIMVYSDSGLNQMSNNYHHLLRERVARGIHKDRQRPILINNWEATYFDFTSEKIKKIVDE
AANLGIEMFVLDDGWFGHRDNDNSSLGDWSEYKEKLSDGLKGVSDYVHQKGLKFGLWFEP
EMISIDSKLYEQHPDYLMQEPGRSPSASRDQHLLDMGRKEVREAVETQIRKIFDTVNIDY
VKWDMNRSMSDAYSIILNAQNQGETAHRYLLGVYELLENLTRDYPEILWEGCSGGGGRFD
TGFLYYMPQSWTSDNTDAVERMNIQYSTSLAYPISSMTAHVSASPNHQTGRSTSLKTRGD
VAMSGVFGYELDLEQLSAAEKEEIAEQVQSYQKIRPLVQYGDFIRLKSPYEGNTVAWMFV
SQDQKEALLFLGRILTNAQAVFNEVKLAGLNKEFVYEDVETKEKYYGDELMTIGMYYPDF
YGDYQTQMIHLRKI
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacaaatgtaatatttcatcaggaggagaaagtttttcacttaaataatggg
aaggtttcttatttaattcagattgaagaagatggtgtagtgagtcatttatactttgga
aaatcattcgaatcttatagtaatcataaaaagtatcctagacgggatcggggattttct
ggaaatgttccaggaaattctgaaagggcatactccaaagatacacttccacaggaattt
tcgagtcatgggtcaatggattaccggattccttcttcgattatccgtcgtgaaagcggt
tctaacttacatgattttcgctactttgattatagaattgaagatggaaaaccggaatta
aaaggactaccgcaggtttatactgaatcagatgaagaggcgaaaacgcttgttttaact
ttaaaagatagggaccaagaaatttatgttgatttaatttatacgatctattctgatcgt
ccgacaattacacgttcaactaaagttaggaacttgactgccaattcaattagtattgaa
aagattgcttctatgcaaatggatttaacaaacagtggtatatacgatgaagtaatttct
ttaccaggagcacatgtccaagaacgacaattacagcgagaaaagatcaatgctggaatt
aaaacttttgaaagtcgaagaggaacaacgagccatcaaatgaatagttttatcgctttg
gtaaaccatgatacgaatgaattttccggaccagccattggactcaattttgtatattct
ggaaatcactcatttgaaattgaaaaagaccaaattgaccaattgcgagttttaatagga
atcaatgattataatttttcttggcaattgaattcaggagaaagttttcaaacacctgaa
gtaattatggtgtactcagattctgggttaaatcagatgagtaacaactaccatcattta
ttaagagaacgtgttgcacgtggaatacacaaagatcgtcaacgtccaattttaattaac
aattgggaagcaacttattttgattttactagtgaaaaaataaagaaaattgttgatgaa
gcagcaaatctagggatagaaatgtttgttttagatgatggttggtttggccaccgagat
aatgataattcatctttaggcgactggtctgaatataaagaaaaactatcagatgggcta
aaaggagtttctgattacgttcatcaaaaaggtttgaagtttggtttatggttcgagcca
gaaatgatttctatcgattctaagttatacgaacagcatcctgattatttaatgcaagaa
cctggtcgctcaccttctgcttctcgtgatcaacatttgctggatatgggcagaaaagaa
gtgagagaagcagtggaaacacaaatacgtaagatttttgataccgttaacatcgactat
gtgaagtgggatatgaatcgaagcatgtctgatgcctattcgattatattgaacgctcaa
aatcaaggtgaaacagcacatcgatatttacttggtgtttatgaactgctagaaaattta
actagggattatcctgagatactttgggaaggttgctccggtgggggcggtcgttttgat
accggctttttatattatatgccccaatcttggacaagtgataacacagatgcagtagaa
cgtatgaatatacagtatagtacaagcttagcttatccgatttcttcaatgactgctcac
gtttctgcttcacctaaccatcaaactggaagaagtaccagtttaaaaacacgaggtgat
gtggcaatgagtggagtatttggttatgagctagatcttgaacaattaagcgcagcagaa
aaagaagaaatagccgaacaagttcaaagctatcaaaaaattcgtccacttgtgcaatat
ggtgattttattcgtctgaaaagcccttatgaaggaaatactgttgcttggatgtttgtt
tctcaagatcaaaaagaagctcttcttttcttaggacgtattctaacgaatgcacaagct
gtatttaatgaagtgaagttagctggattgaataaagaatttgtttatgaagatgtagag
acaaaagaaaaatattacggcgatgaattgatgactatcggtatgtattatccagatttt
tatggagactatcaaacgcaaatgatccacttgaggaaaatatga

DBGET integrated database retrieval system