KEGG   Tetragenococcus halophilus: TEH_19870Help
Entry
TEH_19870         CDS       T01640                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00010  Glycolysis / Gluconeogenesis
thl00052  Galactose metabolism
thl00500  Starch and sucrose metabolism
thl00520  Amino sugar and nucleotide sugar metabolism
thl00521  Streptomycin biosynthesis
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01130  Biosynthesis of antibiotics
thl01200  Carbon metabolism
Module
thl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_19870 (glk)
   00052 Galactose metabolism
    TEH_19870 (glk)
   00500 Starch and sucrose metabolism
    TEH_19870 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TEH_19870 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TEH_19870 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TEH_19870 (glk)
Enzymes [BR:thl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TEH_19870 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-GeneID: 11260315
NCBI-ProteinID: BAK95314
UniProt: G4L2I5
Position
complement(1989607..1990578)
Genome map
AA seq 323 aa AA seqDB search
MAEEKIMGIDLGGTTVKFAILTTEGEIQQKWSIQTNILDEGSHIVPDIIASINHHLNLYD
MQPKDFIGIGMGTPGSVDRKKGTVIGAYNLKWKTTQPVKEQIEKETGISFTLDNDANVAA
LGERWKGAGDNEPDVVFMTLGTGVGGGIIMEGDLLHGAAGCAGEVGHITVDPNGFECTCG
KKGCIETIASATGIVQVARKLSEEYAGTSELKQSLDNGEDITSKDVFKLAEEKEDQLALM
VVDYVCYYLGLACGNLGNSLNPSSLILGGGVSAAGEFLRSKVANYFEQFTFPQVTESTKI
KLAQLGNDAGIIGAASLALKLKD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaaaaattatgggaatcgatttaggtggtacgactgtcaaatttgctatt
ttgacaactgaaggtgagattcagcaaaaatggagtattcaaacgaacattttagatgaa
ggttctcatattgttcctgatattattgcatcaattaatcatcatttgaatttatatgat
atgcagcctaaagattttattggtattggtatggggacaccaggtagtgttgaccggaaa
aaaggaacagttattggtgcttataatttaaaatggaagacaactcaacctgtcaaagaa
caaattgaaaaagaaacaggaatttcttttacactagataatgatgctaatgttgctgca
ttaggtgagcgttggaaaggcgcaggtgacaatgagccagatgttgtgtttatgacattg
ggaaccggcgttggaggtggtatcattatggaaggtgatctcttgcacggcgcagcaggg
tgtgccggagaagtgggtcatatcacagtagacccgaatggttttgaatgtacttgtggt
aaaaagggatgtattgaaacaattgcaagcgcaacaggaattgttcaagtagcccgtaaa
ttgtccgaagaatatgcgggaacatctgaactgaaacagagtttagataatggtgaggat
ataactagtaaagatgtttttaaactagcagaagaaaaagaagatcagcttgcattgatg
gtagtagactatgtttgttattatctaggattagcttgtgggaatttgggcaattcatta
aatccttcttctttaatattaggagggggcgtttcggctgcaggagagtttcttcgtagt
aaggtagcgaactattttgaacaatttactttccctcaagtaactgaaagtacaaaaata
aaattagcgcaactaggaaacgatgctggaattattggtgcggcttcgttagctttgaaa
ctaaaagattag

DBGET integrated database retrieval system