KEGG   Tetragenococcus halophilus: TEH_21000Help
Entry
TEH_21000         CDS       T01640                                 

Gene name
adhE
Definition
multifunctional acetaldehyde/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TEH_21000 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_21000 (adhE)
   00620 Pyruvate metabolism
    TEH_21000 (adhE)
   00650 Butanoate metabolism
    TEH_21000 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    TEH_21000 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TEH_21000 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TEH_21000 (adhE)
   00626 Naphthalene degradation
    TEH_21000 (adhE)
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TEH_21000 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TEH_21000 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2102800..2105490)
Genome map
AA seq 896 aa AA seqDB search
MEKAVQATKEQVTVSEETKEEAARRYTDTLVEKALQAEREFATFTQEQVDKIVNAAALAG
SEAALELAHEAVDETGRGVVEDKDTKNRFATENVYHSVKDDKTVGVIGEDKVSGSVKIAS
PLGVLAGIVPTTNPTSTAMFKSLISLKTRNAIVFAFHPQAQNCSVHAAKIIYDAAVEAGA
PKDIIQWVEKPSLEATSSLIKNPKIASILATGGPGMVNAALQSGNPSMGVGPGNGAIFVD
HTADVSRAVEDLLLSKRFDNGMICATENSAVVEAPVYKEWLEKMQEKGAYLLPKSDYKKV
ADFVFNDNHGVNGAVAGMPARWIAEQAGVKLPEGKDILLFELDPKNIGEKLSSEKLSPLL
SVYKAKDRQDGIKIVDDLLNYQGAGHNAGIQIGSQIDPFVEEYAEKTKASRLIINQPDSI
GAIGDVYTDALKSSLTLGTGSWGKNSLSHNLSTEDLLNIKTVAKRRNRPQWVRLPEKVYY
EENSISYLQDEYEKIERAFIVADPGMVQFGFVDKVYEQLEVRDEPVKSSVYGSVRPDPTL
GQTIEIAQQMQAFKPDAILAVGGGSALDAAKIARYIYEYSLDQEDGFLDSYEKVSEVFVQ
LQQKFLDIRKRIAKFHHSEHTKLFAIPTTSGTGSEVTPFAVITDDHTHVKYPLADYELTP
QVAIVDPAFVMTVPKRTVALSGLDSLSHALESYVSVLSSNFTRPWALEAIKLIFENLETS
YNYDPKNPTSEGENARENMHYAATLAGMSFANAFLGINHSLAHKIGGEFELPHGLAISIA
MNHVIRFNAATGNVKRTPFPRYEVYRGQKDYAEIARYLGLKGSTDAELVESLCAKIDDLM
KAIDVEPTLSANGVTKKHFNQSLDKLVDLVYNDQCTSANPRQPYLEELKQMLIDQF
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagttcaagcaacaaaagagcaagtcacggtaagtgaagagacaaaagaa
gaagctgctcgtcgatatactgatacattagtagaaaaagctttacaagcagaaagagaa
tttgctacatttactcaagaacaagttgataaaattgtgaatgccgcagcacttgctggt
tctgaagctgcattagaattggctcatgaagcagtagatgaaacaggtcgtggtgttgtt
gaagataaagatactaagaaccgttttgccacagaaaatgtgtatcattcggttaaagat
gataaaacagtcggtgtaattggggaggataaggtttcaggtagtgtcaaaattgcttca
ccacttggggttttggcaggtatcgttccgacaacgaatccgacatcaaccgcaatgttt
aagtctttaatatcattgaaaactaggaatgcaattgtttttgcttttcaccctcaagca
caaaattgttcagtgcatgcggcaaaaattatctatgacgcggcagtagaagctggggca
cctaaggatattattcaatgggttgaaaaaccatcgcttgaagcgacatcttccttaatt
aaaaaccctaaaattgcttcaattttagcaacaggcggacctggaatggtcaatgcagct
ttacaatcaggaaacccttcaatgggtgtgggtcccggaaatggcgcgatttttgtagat
catacagctgatgttagtcgtgctgtagaagacttattgttatctaaacgttttgataat
ggaatgatctgcgctactgaaaattcagccgtagtagaagcccctgtttataaagaatgg
ttagaaaaaatgcaggaaaaaggtgcttatttgctgcctaaatcagattataaaaaagta
gcggattttgttttcaatgataaccatggcgttaacggtgctgtagcaggaatgccggcg
cgttggattgctgaacaagcaggagtcaaattaccagaaggaaaagatatcttattgttt
gaattggatcctaaaaatattggagaaaagttatcttcagaaaaactatcgccattactt
tcagtttataaagcaaaagatcgtcaagacggtattaaaattgtggatgatttattgaac
tatcaaggtgcagggcacaatgccggtattcaaatcggttctcaaattgatccatttgtt
gaagaatatgctgaaaagactaaagcttcacgacttatcattaaccaaccagattcaatc
ggtgcaatcggtgatgtttacactgacgcgctaaaatcaagcctaaccttaggtacagga
tcatgggggaaaaattccttgtctcataatttatcaacagaagatttattgaatattaaa
acagttgctaagcgtcgtaaccgtccacaatgggtacgtttaccagagaaagtttattat
gaagaaaattctatttcatatctacaagatgaatatgagaaaatagaaagggcatttatt
gtagccgacccaggcatggtacaatttggttttgtcgataaagtatatgaacaattagaa
gttcgtgatgaaccggtaaaatcttcagtatatggttctgtaagacctgacccaacttta
ggccaaaccatagagatagcgcaacaaatgcaagcatttaaaccagatgccattttagca
gtaggtggtggttcagccttagacgcagctaaaattgctcgttatatctatgagtattct
cttgatcaagaagacggatttttggatagttacgaaaaagtaagcgaagtatttgttcaa
ttacaacaaaaattcttagatatccgtaaacgtattgcgaaattccatcattctgaacat
acaaaactatttgctataccaacgacttcagggacgggttctgaggtaacaccatttgct
gtaattacagatgatcatacacacgtgaaatatccattagctgactatgaattaacgccg
caagtagcgattgttgatccagcatttgttatgacagtgccaaaaagaacggttgcctta
tcagggcttgattcactatcacatgctttagagtcatatgtttccgttctttcctcaaac
tttactcgcccttgggcactagaagcgattaaactaatctttgagaatttggaaacgtct
tataattacgatccaaaaaacccaacatcagaaggcgaaaatgctcgtgaaaacatgcac
tatgcagcaactcttgcaggtatgtcatttgccaatgcattcttaggaattaatcattca
ctcgctcataaaatcggcggagaattcgaacttccgcacggcttagccatttcaattgct
atgaatcacgtcattcgctttaatgccgcgactggtaatgtaaaacggacgccattccct
cgttatgaagtgtatcgtggacaaaaagattatgctgaaattgcccgttacttagggttg
aaaggatcaacagatgctgaattagtagaatcattatgtgcaaaaattgatgatttaatg
aaagctatcgatgtcgaaccaacactttcagctaacggcgttacgaaaaaacacttcaac
caatcacttgataaacttgttgacttggtttacaacgaccaatgtacttcagcgaatcct
cgtcaaccgtatttggaagaattgaaacagatgttgattgatcagttttaa

DBGET integrated database retrieval system