KEGG   Tetragenococcus halophilus: TEH_21960Help
Entry
TEH_21960         CDS       T01640                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
thl  Tetragenococcus halophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:thl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2207208..2207801)
Genome map
AA seq 197 aa AA seqDB search
MYEYIIGKLTEIHPAYIVLENNGVGYQIAAGNPYQYSSQVNQQVKIFVHQVIREDAHTLY
GFNTLEEKNLFLRLISVSGIGPKSGLAIMANEDHEGLIAAIESSNINFLTKFPGVGKKTA
QQLILDLQGKLGEAPATNQNTDQSSLENSALEEAMEALQALGYTEKEVKKSYKSLKEEEA
MTTDEYLRKALKIMMKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattatcggtaaattaacagagatccacccagcgtatattgttctggaa
aataatggcgttggttatcaaattgctgcaggaaatccttatcaatatagtagtcaagtt
aatcaacaagtgaaaatttttgtacatcaagtcattcgtgaagatgcgcatacattgtat
ggttttaatacccttgaagaaaaaaatctatttttacgattaatcagtgtttctggaatt
gggcctaaaagtggtctagcaattatggcaaatgaagatcatgaaggtttgattgcagca
atagaatcttctaatattaattttttaacgaagtttccgggtgtgggtaaaaaaaccgcc
caacaattaattttggatttgcaaggaaagcttggcgaagcaccagcaacaaaccaaaat
acagaccaatcttccttagaaaattccgctttagaagaagctatggaagctttacaagcg
ttaggttatactgaaaaggaagttaaaaagagttataagtcgttaaaagaagaagaggca
atgacgacagatgaatatttgagaaaagccttgaagataatgatgaagaagtaa

DBGET integrated database retrieval system