KEGG   Tetragenococcus halophilus: TEH_22910Help
Entry
TEH_22910         CDS       T01640                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00010  Glycolysis / Gluconeogenesis
thl00260  Glycine, serine and threonine metabolism
thl00680  Methane metabolism
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01130  Biosynthesis of antibiotics
thl01200  Carbon metabolism
thl01230  Biosynthesis of amino acids
Module
thl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thl_M00002  Glycolysis, core module involving three-carbon compounds
thl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_22910 (gpm)
  Energy metabolism
   00680 Methane metabolism
    TEH_22910 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TEH_22910 (gpm)
Enzymes [BR:thl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TEH_22910 (gpm)
Membrane trafficking [BR:thl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TEH_22910 (gpm)
Exosome [BR:thl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TEH_22910 (gpm)
  Exosomal proteins of melanoma cells
   TEH_22910 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 11261388
NCBI-ProteinID: BAK95618
UniProt: G4L3E2
Position
2295985..2296653
Genome map
AA seq 222 aa AA seqDB search
MPKLIFARHGKSEWNKADKFTGWVDVDLAPEGVEEAKDAGQKLKEAGIEFDIAYTSVLTR
AIKTCHYILEETDQLWVPEVKSWRLNERHYGALQGLNKQNTRDKYGDEQVHIWRRSYDTL
PPLTDPEPDRRYADLDPRTIPGGENLKVTLERALPFWEDQIAPALREGKTVLVAAHGNSL
RALAKHIEGISDDDIMDLEIPTGKPSVYELNDDLTVKEKYYL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaatttttgcacgtcacggaaaaagtgaatggaataaagcagataagttc
actggttgggtcgacgtagacttggcgccagaaggtgtagaagaagcaaaagatgccggt
caaaaacttaaagaagcgggcattgaatttgatattgcttatacttctgttttaactcgc
gcaattaaaacttgccactatattttagaagaaaccgaccaattatgggtaccagaagta
aaatcttggcgcttgaacgaacgtcactatggcgctttacaaggtttaaacaaacaaaat
acgcgtgataaatacggtgacgaacaagtccatatttggcgtcgttcttatgatacgttg
cctccattaacagaccctgaacctgatcgtcgttatgctgatctagacccaagaacaatt
cctggtggcgaaaacttgaaagttacgcttgaacgtgctttgccattttgggaagatcaa
atcgctcctgcattgcgcgaaggaaaaactgttttagttgcagcacacggcaattcctta
cgggctttagcaaaacatatcgaaggaatttctgatgatgacattatggatcttgaaatt
ccaacaggaaaaccaagcgtttatgaattaaacgacgacctaacagtcaaagaaaaatat
tatttataa

DBGET integrated database retrieval system