KEGG   Tetragenococcus halophilus: TEH_22910Help
Entry
TEH_22910         CDS       T01640                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
thl  Tetragenococcus halophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEH_22910 (gpm)
   01230 Biosynthesis of amino acids
    TEH_22910 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEH_22910 (gpm)
  Energy metabolism
   00680 Methane metabolism
    TEH_22910 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TEH_22910 (gpm)
Enzymes [BR:thl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TEH_22910 (gpm)
Exosome [BR:thl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TEH_22910 (gpm)
  Exosomal proteins of melanoma cells
   TEH_22910 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2295985..2296653
Genome map
AA seq 222 aa AA seqDB search
MPKLIFARHGKSEWNKADKFTGWVDVDLAPEGVEEAKDAGQKLKEAGIEFDIAYTSVLTR
AIKTCHYILEETDQLWVPEVKSWRLNERHYGALQGLNKQNTRDKYGDEQVHIWRRSYDTL
PPLTDPEPDRRYADLDPRTIPGGENLKVTLERALPFWEDQIAPALREGKTVLVAAHGNSL
RALAKHIEGISDDDIMDLEIPTGKPSVYELNDDLTVKEKYYL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaatttttgcacgtcacggaaaaagtgaatggaataaagcagataagttc
actggttgggtcgacgtagacttggcgccagaaggtgtagaagaagcaaaagatgccggt
caaaaacttaaagaagcgggcattgaatttgatattgcttatacttctgttttaactcgc
gcaattaaaacttgccactatattttagaagaaaccgaccaattatgggtaccagaagta
aaatcttggcgcttgaacgaacgtcactatggcgctttacaaggtttaaacaaacaaaat
acgcgtgataaatacggtgacgaacaagtccatatttggcgtcgttcttatgatacgttg
cctccattaacagaccctgaacctgatcgtcgttatgctgatctagacccaagaacaatt
cctggtggcgaaaacttgaaagttacgcttgaacgtgctttgccattttgggaagatcaa
atcgctcctgcattgcgcgaaggaaaaactgttttagttgcagcacacggcaattcctta
cgggctttagcaaaacatatcgaaggaatttctgatgatgacattatggatcttgaaatt
ccaacaggaaaaccaagcgtttatgaattaaacgacgacctaacagtcaaagaaaaatat
tatttataa

DBGET integrated database retrieval system