KEGG   Thermococcus sp. CL1: CL1_0239Help
Entry
CL1_0239          CDS       T02169                                 

Definition
aldehyde: ferredoxin oxidoreductase 1
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thm  Thermococcus sp. CL1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:thm01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:thm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212063..213919)
Genome map
AA seq 618 aa AA seqDB search
MFAYHNKIARVNLTTGKVTYEELPDDVTRKFIGGKGLGYYLIYREVPPGTDPLSEANKFV
FAPGGLTGLIPGSSKVIAVSKSPETRLISDSSGGDAFGPKLKGHFDALVIEGKAEEPVYL
HVHDGEVEIRDAKHLWGKGNYEVAGELWKEYPKASIASIGPAGEKLSRIANVIYDTERAS
GRGGLGAVLGSKKVKAVVVEPGEKPGVAEPEEFQRLWREFYDHFATDPKYEHSRNYGTSD
GLRSSASLGMSPAYNFSRPHIPDELASKLAGDEVKKYEVEPEWFVHGKSCPIKCARYVEV
EYRGRKIRVKPEYESIAMLGAATGVFNFPAVAYFNWLVNDLGLDSIATGNTIGWLFEMVE
RGLVGKEEIGFPVKGWGDEEAEERLIRLMAERKGIGAVLADGVKRACERLGRGCEFAVHV
KGMESPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGPAKELVPSLIEARDESY
ITDMLGTCKFVSYKMEDLARFYSLATGEEWTVEELRKRAWAVESIARIHDALDWVTPPLD
DVIPPRWWEPEPDGPAEGNKAFTDHNDFLEARREFYRLRGWHEELGVPLPETMEELGYGE
FRGDAERALEVVRKRVGV
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcctaccacaacaaaatagcgcgggtaaatctgacaactggaaaggttacctac
gaggaactccccgatgatgtcacaaggaagttcatcggcgggaagggcctcggctactac
ctgatctaccgcgaggttccgccgggaaccgacccgctgagcgaggcgaacaagtttgtc
ttcgcccccgggggattgaccggcctcattcctggctcaagcaaggtcatagcggtgagc
aagagtcccgagacgcgcctgataagcgactccagcggcggggacgccttcgggcccaag
ctcaagggccacttcgatgcgctggtcatagagggaaaggccgaggagccggtttacctc
cacgttcacgacggggaggtcgagatcagggacgcgaagcatctctgggggaagggcaac
tacgaggttgccggggagctgtggaaagaatatcctaaggcgagcatagcctcgataggc
cccgccggcgaaaagctgagcaggatagccaacgttatctacgacaccgagagggccagc
ggcaggggcggtctcggcgccgttctcgggagcaagaaggtcaaagctgttgtcgtcgag
ccgggtgaaaagcccggggttgcggagccggaggagttccagaggctctggcgggagttc
tacgaccacttcgccacagaccccaagtacgagcacagcaggaactacggcacgagcgat
ggcctgaggagctcagcttccctcggaatgagcccggcctacaacttctcgaggccccac
ataccggacgagcttgcgagcaaactggctggagacgaggtcaagaagtacgaggttgag
ccggagtggttcgtccacggcaagagctgtccgataaagtgcgcccgttacgtcgaggtg
gaatacaggggaagaaaaatccgcgtcaagcccgagtacgagagcatagccatgctcgga
gcagcaaccggagtgttcaactttccagccgttgcgtacttcaactggctggtgaacgac
ctcgggctggacagcatagctaccggtaacaccatcggctggctcttcgagatggtagag
cgcggtctcgtcgggaaggaggagataggcttccccgttaaaggctggggcgacgaggag
gccgaggagaggctcataaggctgatggccgagaggaagggcatcggcgcggttctggcg
gacggtgtgaagagggcctgcgagcgcctgggtagaggttgtgagttcgcggtacacgtc
aagggcatggaaagccccgcctgggacccgcgcggaaggagaacctacgctttaagctac
gccacggcagacgtcggagcgagccacctccgtggctggccgaggccccaccagctcccc
aaccaggggcctgcgaaggagctggtgccctcgctcatcgaggcgagggacgagagctac
atcaccgacatgctcggaacctgcaagttcgtgtcctacaagatggaagacctggccagg
ttctactccctcgcgacgggcgaggagtggacagtggaggagcttagaaaaagggcctgg
gcggttgagagcatcgcgcgcatacacgacgccctcgactgggtcacgccgccgctcgac
gatgtaattccgccgcgctggtgggagccggagccggacgggccggcggagggcaacaaa
gctttcactgaccacaacgacttccttgaggctaggagggagttctacaggctcaggggc
tggcacgaggagcttggcgttccattgccggagacgatggaggagctcggttatggggag
ttcaggggagatgcggagagggcactggaggtcgtgaggaagagggtgggagtttag

DBGET integrated database retrieval system