KEGG   Thermococcus sp. CL1: CL1_0467Help
Entry
CL1_0467          CDS       T02169                                 

Definition
putative phospho-sugar mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_0467
   00030 Pentose phosphate pathway
    CL1_0467
   00051 Fructose and mannose metabolism
    CL1_0467
   00052 Galactose metabolism
    CL1_0467
   00500 Starch and sucrose metabolism
    CL1_0467
   00520 Amino sugar and nucleotide sugar metabolism
    CL1_0467
  Nucleotide metabolism
   00230 Purine metabolism
    CL1_0467
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CL1_0467
Enzymes [BR:thm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CL1_0467
    5.4.2.8  phosphomannomutase
     CL1_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(430938..432308)
Genome map
AA seq 456 aa AA seqDB search
MGRLFGTFGVRGIANEKITPEFALKMGMAFGTMLRREGRKRPLVVVGRDTRVSGEMLKNA
LISGLLSVGCDVIDVGIAPTPAIQWATAHFKADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAVVEEVFFKEDFDRARWDEIGEVREEDIIKPYIEAIKARVDVEAIRKRRPFVVVD
VSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLRGFMEIVKALGADFGV
AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIAKRNNA
EVLRTKVGDLIVARALLEHNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSGKKF
SELIDELPKYYQFKTKRHVEGDRKAIVAKVAELAEKKGYRVDTTDGTKILFEDGWVLVRA
SGTEPIIRVFSEAKSEEKAREYLELGLGLLEEAIRR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggctctttgggaccttcggcgtcagggggatagcgaacgagaagataacgcct
gagtttgccctcaagatgggcatggccttcggaaccatgctcaggagggaggggaggaaa
aggccgctcgtcgtagtcggcagggacacccgcgttagcggggagatgctgaaaaacgca
ttgataagcggcctcctcagcgtcggctgcgacgtcattgatgtcggcatcgctccaacg
cctgcaatccagtgggccacggctcacttcaaggccgacggtggggccgttataaccgct
tcccacaatccacccgaatacaacggcataaagctcctcgaaccgaacggcatgggactt
aagaaggagagagaagcggttgtcgaggaggtcttctttaaagaggacttcgacagggcc
aggtgggacgagataggcgaggtcagggaggaggacatcatcaagccctacatcgaggcg
ataaaggctcgcgttgacgttgaggcgataaggaagaggaggcccttcgtggtcgtcgat
gtctccaacggcgccggctctctaacgctcccctacctcctcagggagctcggctgtaaa
gtggtgagcgtgaacgcccaccccgacggccactttcctgctagaaaccccgagcccaac
gaggagaacctgagggggttcatggagattgtgaaggctttgggtgccgacttcggggtc
gcccaggacggcgacgccgacagggctgtcttcatagacgagaacggccgcttcatacag
ggcgacaagacattcgcgctcgttgccgatgccgttctgagggagaacggcggtgggctt
ctcgttaccacgatagcgacctctaacctgctcgatgacatagcgaagaggaacaacgcg
gaggtgctgaggacgaaggtaggcgacctcatcgttgcgagggcactccttgaacacaac
ggaaccatcggcggcgaggagaacgggggtgtaatctttccggacttcgtgctcggcagg
gacggggcgatgacaacggcaaaaatagtcgagatcttcgcaaagtcgggcaagaagttc
agcgagctgattgatgagcttccgaaatactaccagttcaagacgaagaggcacgttgag
ggcgacaggaaggcgatagtggcgaaggtggcggagctcgctgaaaagaagggttacagg
gtggacaccaccgacggaaccaaaattctctttgaagacggctgggtactcgtgagggcc
agcggaacggagccgataattagggtcttcagcgaggcgaagagcgaggaaaaagccagg
gagtacctcgagctcgggctggggcttctggaagaggctataagaaggtga

DBGET integrated database retrieval system