KEGG   Thermococcus cleftensis: CL1_0537Help
Entry
CL1_0537          CDS       T02169                                 

Definition
(GenBank) threonine synthase 1
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thm  Thermococcus cleftensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CL1_0537
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CL1_0537
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CL1_0537
Enzymes [BR:thm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CL1_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(494142..495473)
Genome map
AA seq 443 aa AA seqDB search
MRVRCPGCGRLYSSLIPPTCSCGEPLRITYDYDSIDPSAWRDRKPGVWRYRELLPEVHEV
VSLSEGGTPLLRAKLGGELGLKIFIKDETRNPTGSFRDRLITVAVSYGLPHADNGFVIAS
NGNAAASLAAYASRAGRPAYVVVPKLIEQGKLNQIAALGAKVIRYGESVDEGISYAEGLA
EGKGLYNVTPESNLVGLEGQKTLAFELWEELDPTHVIVPTGSGSNLYSIYKGFVELREIG
AIEELPRLIAVQAEKCSPIASEILGVEPRAEPTKALGLYVKNPVMKELALKAIDESGGTA
VLVGEDELDLGQRLLAKEGIFAEYASAVIVPALLKLAEEDYFERDDRIALVVTSSGLKGH
YSESRERFSVGGTKLEILRLLSEKSMYGYEIWEALEKPLKYQAVYQHLRELESMGLIEET
HRRGRRVYYGLTERGRRFLETLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagggttcgctgtccgggctgtgggaggctttactcctccctcattcctcctacgtgc
tcctgtggcgagccccttaggataacctacgactacgattccatcgacccctccgcgtgg
agggacagaaagcccggggtgtggaggtacagggagcttctaccagaggttcacgaagta
gtaagcctgagcgagggcgggacgcctctgctgagggcaaagcttgggggcgaacttggg
ctgaagatattcatcaaggacgagacgagaaatccgactggctcttttcgcgacagactc
ataactgtggcggtttcctacggcctgcctcacgccgacaacggcttcgtcatagcaagc
aacgggaacgccgcggcctccctcgcggcctatgcctcacgggctggaaggcctgcctac
gtcgtggttcctaagctaatagagcagggaaagctcaaccagatagcggccctcggggcc
aaggttatacgctacggcgaaagcgtggacgagggcataagctacgccgagggcctggcg
gaggggaagggactgtacaacgttaccccggagagcaacctggtcggcctggaggggcag
aaaacgctggccttcgagctgtgggaggagctggacccgactcacgtgatagttccaacc
ggcagtgggagcaacctctacagcatctacaagggcttcgtggagctgagggaaataggt
gccatcgaagagcttcccaggctgatcgcggttcaggccgagaagtgctctccaatagcg
agcgaaatcctcggcgttgaaccaagagccgagccgactaaggcccttggcctgtacgtg
aagaaccccgtgatgaaggagctcgccctcaaggccatagacgagagcggcggaaccgcg
gttctcgtgggggaggacgagcttgaccttggccagagactccttgccaaggaaggaatc
ttcgccgagtacgcctcggcggttatagttcctgccctcctcaagctggctgaggaagac
tacttcgaacgcgacgacaggatagccctggtcgtgacgagctccggcctcaagggccac
tactccgagagccgcgagaggtttagcgttggggggaccaagctggagatactcagactg
ctgagcgagaagagcatgtacggttacgagatatgggaggccctggagaagcccctcaag
tatcaggcggtttaccagcacctccgcgagcttgaaagcatggggctaattgaggagacc
cacaggaggggcaggagggtctactacgggctgacggagaggggaaggaggttcctcgaa
accctcgggtag

DBGET integrated database retrieval system