KEGG   Thermococcus sp. CL1: CL1_0537Help
Entry
CL1_0537          CDS       T02169                                 

Definition
threonine synthase 1
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CL1_0537
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CL1_0537
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CL1_0537
Enzymes [BR:thm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CL1_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(494142..495473)
Genome map
AA seq 443 aa AA seqDB search
MRVRCPGCGRLYSSLIPPTCSCGEPLRITYDYDSIDPSAWRDRKPGVWRYRELLPEVHEV
VSLSEGGTPLLRAKLGGELGLKIFIKDETRNPTGSFRDRLITVAVSYGLPHADNGFVIAS
NGNAAASLAAYASRAGRPAYVVVPKLIEQGKLNQIAALGAKVIRYGESVDEGISYAEGLA
EGKGLYNVTPESNLVGLEGQKTLAFELWEELDPTHVIVPTGSGSNLYSIYKGFVELREIG
AIEELPRLIAVQAEKCSPIASEILGVEPRAEPTKALGLYVKNPVMKELALKAIDESGGTA
VLVGEDELDLGQRLLAKEGIFAEYASAVIVPALLKLAEEDYFERDDRIALVVTSSGLKGH
YSESRERFSVGGTKLEILRLLSEKSMYGYEIWEALEKPLKYQAVYQHLRELESMGLIEET
HRRGRRVYYGLTERGRRFLETLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagggttcgctgtccgggctgtgggaggctttactcctccctcattcctcctacgtgc
tcctgtggcgagccccttaggataacctacgactacgattccatcgacccctccgcgtgg
agggacagaaagcccggggtgtggaggtacagggagcttctaccagaggttcacgaagta
gtaagcctgagcgagggcgggacgcctctgctgagggcaaagcttgggggcgaacttggg
ctgaagatattcatcaaggacgagacgagaaatccgactggctcttttcgcgacagactc
ataactgtggcggtttcctacggcctgcctcacgccgacaacggcttcgtcatagcaagc
aacgggaacgccgcggcctccctcgcggcctatgcctcacgggctggaaggcctgcctac
gtcgtggttcctaagctaatagagcagggaaagctcaaccagatagcggccctcggggcc
aaggttatacgctacggcgaaagcgtggacgagggcataagctacgccgagggcctggcg
gaggggaagggactgtacaacgttaccccggagagcaacctggtcggcctggaggggcag
aaaacgctggccttcgagctgtgggaggagctggacccgactcacgtgatagttccaacc
ggcagtgggagcaacctctacagcatctacaagggcttcgtggagctgagggaaataggt
gccatcgaagagcttcccaggctgatcgcggttcaggccgagaagtgctctccaatagcg
agcgaaatcctcggcgttgaaccaagagccgagccgactaaggcccttggcctgtacgtg
aagaaccccgtgatgaaggagctcgccctcaaggccatagacgagagcggcggaaccgcg
gttctcgtgggggaggacgagcttgaccttggccagagactccttgccaaggaaggaatc
ttcgccgagtacgcctcggcggttatagttcctgccctcctcaagctggctgaggaagac
tacttcgaacgcgacgacaggatagccctggtcgtgacgagctccggcctcaagggccac
tactccgagagccgcgagaggtttagcgttggggggaccaagctggagatactcagactg
ctgagcgagaagagcatgtacggttacgagatatgggaggccctggagaagcccctcaag
tatcaggcggtttaccagcacctccgcgagcttgaaagcatggggctaattgaggagacc
cacaggaggggcaggagggtctactacgggctgacggagaggggaaggaggttcctcgaa
accctcgggtag

DBGET integrated database retrieval system