KEGG   Thermococcus sp. CL1: CL1_0684Help
Entry
CL1_0684          CDS       T02169                                 

Definition
pyrazinamidase/nicotinamidase-like protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
thm  Thermococcus sp. CL1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CL1_0684
Enzymes [BR:thm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CL1_0684
    3.5.1.-  
     CL1_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(620018..620563)
Genome map
AA seq 181 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPEGDRIIPRCNRYIEEFRRRGALIVATRDWHPENHIS
FRENGGPWPRHCVQNTPGAEFVVELPADAVIISKATEPDKEAYSGFEGTELAEILKRNGV
KRVYICGVATEYCVKATALDAVKHGFETYLLRDAVKGINPEDEGRALKELEGAGVKVLSR
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaggcgctcatagttgtggacatgcagagggacttcatgcccggcggggct
ttgcccgttccggagggggacaggataataccccggtgcaaccggtacatcgaggagttc
cggaggaggggggctttgatagttgccacccgcgactggcacccggagaaccacatcagc
ttcagggagaacggcggcccctggccgaggcactgcgtccagaacacgccgggggcagag
ttcgtcgtggagcttccagctgacgctgttataatctcgaaggcgacggagccggacaag
gaggcctattcaggcttcgagggaactgaactggcggagattctgaagagaaacggcgta
aaaagggtctacatctgtggggtggcgaccgagtactgcgtaaaggccacagccctagat
gcggtaaagcacggctttgaaacatatctcctccgcgatgccgtgaagggaatcaaccct
gaggacgaggggcgggctttgaaggagcttgagggtgccggtgtgaaggttctctctcgt
ttatga

DBGET integrated database retrieval system