KEGG   Thermococcus sp. CL1: CL1_0896Help
Entry
CL1_0896          CDS       T02169                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
thm  Thermococcus sp. CL1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:thm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859117..860331
Genome map
AA seq 404 aa AA seqDB search
MVETLVELIKIPAISPDYGYEGEYDKAQKLLEIIKDWPFDKVEVYNAPDERAKNGVRPSI
LAYYYGEKGEEGPRLWILTHIDVVPPGDLSKWTVTEPFKPVVKDGKVYGRGSEDNGQSLV
ASLYAVRAMMNLGIRPKRTVILAFVSDEETGSKYGVEWLMREHPELFRKDDLVLVPDGGN
EEGTFIEVAEKSILWLRVKVRGKQVHASMPDKGLNAHRVALDFAYHLDRLLHEKYGERDE
LFDPPESTFEPTMVRGPADSPNIVPGEHEVVFDCRILPRYSIDDILADAERLAGEVREKY
RREFDGKVLPEIEFEVLQRMDAPEPTDPNSEIVLLLKEAIRRLRGKEAKVGGIGGGTFAA
YFRKLGIPAVVWATLDETAHQPNEYARIKNMVEDAKVMAALALL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagacgctcgtcgaactgattaagatcccggccataagcccggactacggctac
gagggtgaatacgacaaggcccagaagcttttggagataatcaaggactggcccttcgac
aaagttgaagtctacaacgcgccggacgagagggccaagaacggtgtcaggccgagcatt
ttagcgtactactacggtgagaagggcgaggaaggcccgaggctctggatcctcacccac
atcgacgttgtcccgcccggagatttaagcaagtggacggtcacggagccgttcaagccg
gtcgtcaaggacggcaaggtctacggcaggggaagcgaggacaacgggcagagcctcgtg
gcttcactttacgcggtcagggccatgatgaacctcgggataagaccgaagagaaccgtc
attctggccttcgtcagcgatgaagagaccggaagcaagtacggcgtcgagtggctgatg
agggagcacccggagctgttccgcaaggacgacctcgttctcgttccggacggcgggaac
gaggagggcaccttcatcgaggtggccgagaagagcattctctggctcagggtcaaggtc
aggggcaagcaggttcacgcgagcatgccggacaaaggcctgaacgcccaccgcgtcgcc
cttgacttcgcctaccacctcgacagactgctccacgagaagtacggtgagagggacgaa
ctcttcgaccctccggagagcaccttcgagccgacgatggttcgcggcccggccgacagc
ccgaacatagtgcccggcgagcacgaggtcgtcttcgactgcaggattctgccgaggtac
agcatagacgatatccttgccgacgccgagaggcttgccggagaggtcagggagaagtac
aggcgggagttcgatggaaaagtcctgccggagatagagttcgaggttctccagcgcatg
gacgccccggagccgacggatccgaacagcgagatagttctcctgctcaaggaggccatc
aggaggctccgcggaaaggaggcgaaggtcggcggaataggtggcggaaccttcgcggcc
tacttcaggaagctcggaatcccggcggttgtgtgggcaacgctcgacgagaccgcccac
cagcccaacgagtacgcccggataaagaacatggtcgaagatgcgaaggtcatggcggct
ttagcactcctgtga

DBGET integrated database retrieval system