KEGG   Thermococcus sp. CL1: CL1_0953Help
Entry
CL1_0953          CDS       T02169                                 

Definition
histone acetyltransferase-like protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
thm  Thermococcus sp. CL1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(915849..917621)
Genome map
AA seq 590 aa AA seqDB search
MEERFGKAVEELARLVMSGEIKSREELNRWKIKVSRKYHLSKIPGNSDILKAIPEERREE
FRELLKRKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGREPSALRAVQ
SAYHPYIIMMRRLKQLTDIGHDVDKVEVIIQGGTFPAVDLDYQEWFVKEAFKAMNDFPHF
RDIENLEEKLVRLIVKRDESVLEEDPKFREAWLKTHSKPYYYLEDEQRRNERAKVRMVGL
TIETRPDWAFERHIDRMLKLGTTRVELGVQTIFNFIHERTRRGHGVEEIVKATQLLRDAG
LKINYHIMPGLPGSNFERDLYTFRTIFEDTRFRPDMLKIYPTLVTKDAPLYRWWKEGKYR
PYRTEEAVELLVEAYKLFPKWVRVMRIQRDIPVQLIVDGVKHSNLGQLVFNELIKRGIRP
REIRFREVGHMMEKFGIQPEVEHIKLLREDYGASGGREIFLSFEDVKNDILIGFLRLRIP
SEKAHRREIKCCPSAIVRELHVYGPLVPIGGKPRYEWQHRGYGRELLSEAERIAREEFDV
KKMLVISGVGVREYYRKFGYRKNGPYVAKRLDKSYGDYKKSREFDAHLNT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaggttcggaaaagctgtggaggagctcgcgagactggttatgtcgggtgag
attaagagcagggaggagctcaaccgctggaagatcaaggtctcgcgtaagtatcatctc
tcaaagattccgggcaactccgacatcttgaaggccattccggaggagaggcgcgaggag
ttcagggaactgctcaaaaggaagcctacgaggacgataagcggcgtcgcggtagttgcc
atgatgaccaagccatttccctgcccacacgggcgttgcatctactgcccaggcgggccc
agcgtcggctctccccagagctacacagggagggaaccttcagccttgagggccgttcag
agcgcctaccacccctacataatcatgatgcgtcgcctgaagcagctcaccgacatcggg
cacgacgtggacaaggtcgaggtcataatccagggaggaacctttcccgcggttgatctg
gactatcaggagtggttcgttaaagaggccttcaaggcgatgaacgacttccctcacttc
agggatatagagaaccttgaggagaagctcgtcaggttgatagtgaaaagagacgagtcc
gtcctggaggaggaccccaagttcagggaggcgtggcttaagacacactcaaagccctac
tactaccttgaggacgagcagaggaggaacgagagggctaaggtcagaatggtcgggctt
acgatagagacgcgcccggactgggcctttgagaggcacatagacaggatgctgaagctc
ggaacaacgagggttgagctcggcgttcaaacgattttcaacttcattcatgagagaacc
aggcgcggtcacggcgtcgaggagatagttaaggccactcaacttctccgcgatgcgggc
cttaaaatcaactaccacataatgcccggccttcccgggagcaacttcgagagggacctc
tacactttcaggacgatcttcgaggatacccggttccgccctgacatgctgaaaatttac
cccactctcgtgaccaaagacgctcccctctaccgctggtggaaggagggtaaatatcgt
ccctatcgcactgaggaggccgttgagctcctcgtcgaggcctacaagctcttccccaag
tgggttcgcgtgatgagaatccaacgcgacattcccgtccagctaatcgtcgacggcgtc
aagcactccaatctgggccagctggtcttcaacgagctgataaagcgcggtataaggccg
agggaaatccgctttagagaagtcggccacatgatggagaagtttggaatccagcccgag
gttgagcacataaagctcctccgcgaggactacggggcatctggcggaagggaaatcttc
ctgagcttcgaggacgtcaagaacgacatactgatagggttcttgaggctgaggattccg
agcgagaaggcccacaggagagagataaaatgctgtccttccgctatagtcagggagctc
cacgtttacggccccctcgtgccgattggtggtaaacctaggtacgagtggcagcaccgc
ggttacggaagggagcttttgagcgaggccgagaggatagcgagggaggagtttgacgtc
aagaagatgctagttataagcggcgtcggcgtgagggagtactacagaaagttcggctac
cggaagaacgggccctacgtcgccaagaggctcgacaaaagctatggggattacaaaaag
agcagggagttcgacgcgcacctgaacacctag

DBGET integrated database retrieval system