KEGG   Thermococcus cleftensis: CL1_1083Help
Entry
CL1_1083          CDS       T02169                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thm  Thermococcus cleftensis
Pathway
thm00010  Glycolysis / Gluconeogenesis
thm00051  Fructose and mannose metabolism
thm00562  Inositol phosphate metabolism
thm01100  Metabolic pathways
thm01110  Biosynthesis of secondary metabolites
thm01120  Microbial metabolism in diverse environments
thm01130  Biosynthesis of antibiotics
thm01200  Carbon metabolism
thm01230  Biosynthesis of amino acids
Module
thm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thm_M00002  Glycolysis, core module involving three-carbon compounds
thm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1083
   00051 Fructose and mannose metabolism
    CL1_1083
   00562 Inositol phosphate metabolism
    CL1_1083
Enzymes [BR:thm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CL1_1083
Exosome [BR:thm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CL1_1083
  Exosomal proteins of bladder cancer cells
   CL1_1083
  Exosomal proteins of melanoma cells
   CL1_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS DHO_dh NMO His_biosynth B12-binding NanE
Motif
Other DBs
NCBI-ProteinID: AFL95286
UniProt: I3ZUA2
Position
complement(1055326..1056006)
Genome map
AA seq 226 aa AA seqDB search
MAKLREPIIAINFKTYAQATGEGALRIAKAAEKVWKETGITIVVAPQLADLYRIAQEVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMVLADLEAAIRRAEEVGLMT
MVCSNNPTVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKRVNPDVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLIL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctgagggagccgatcatagcgattaacttcaagacctacgcccaggcgacg
ggtgaaggggctttaaggatagccaaggcggcagagaaggtgtggaaggagaccggcata
accatcgtcgttgccccgcagctggcagacctctaccggatagcccaggaggtcgagatc
ccggtctttgcccagcacatcgacccgataaagcccggaagccacaccggccacgttctg
ccggaggccgtgaaggaagccggagcggtgggaacgctcctcaaccactccgagaacaga
atggtcctggcggatcttgaggcggccataaggcgcgccgaggaagttgggctaatgacg
atggtctgctccaacaacccgaccgtttcagcggcggtggcggcactcggcccggactac
gttgccgtcgagccgcctgaactgatagggactgggatcccggtcagcaaggcgaagccc
gaggtcataaccaacacggtcgagctggttaaaagagtcaatccagacgtgaaggttctc
acgggcgcgggaataagcacgggcgaggacgtcaagaaggctttggagctcggaagcgtc
ggcgttcttctcgcaagcggagtaaccaaggccaaggacccggagaaggcgataagggat
ctagtgtctctgattctctga

DBGET integrated database retrieval system