KEGG   Thermococcus sp. CL1: CL1_1185Help
Entry
CL1_1185          CDS       T02169                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thm  Thermococcus sp. CL1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CL1_1185
Enzymes [BR:thm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CL1_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149726..1150289)
Genome map
AA seq 187 aa AA seqDB search
MSRAIKTQLVRYSRKAHERGLTAAFGGNLSVRSGGLVFIKATGAVMDEMTGEQVAVVSID
GNQISGVRPSSEYRLHLEVYRRRPDVRAIVHLHPPYAIAASTTVDVELPVITPEAEIYLK
RIPVVPFRPAGTQELAEVVADALCHADAVIMERHGTVTVGRSLREAFYKAELVEESAKLW
YLSKRDK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggcaatcaaaacccagctcgttaggtactccagaaaggcccacgagcgcggt
ttgacggccgcctttggcggaaacctgagcgtcaggagcgggggtctcgtttttatcaag
gccacaggggcagtgatggacgagatgactggagaacaggtggcggtggtgagcatagat
ggaaaccagatttcgggagttaggccttcctccgagtacaggctccacctggaggtctac
aggaggaggcccgacgtcagggcgattgttcacctgcacccgccgtacgccatagcggcc
tccaccacggtggacgtggagctaccggtaataacgccggaggcagagatatacctaaaa
aggattccagtagtcccgttcagacccgcgggaacccaggagctggcggaggttgttgcc
gacgccctctgccacgccgatgcggtgataatggagaggcacggcacggttacggtcggg
agaagtctcagggaggcgttctacaaggcggagctcgttgaggagagcgcgaagctctgg
tacctgagcaaaagggacaagtga

DBGET integrated database retrieval system