KEGG   Thermococcus sp. CL1: CL1_1205Help
Entry
CL1_1205          CDS       T02169                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CL1_1205
   01230 Biosynthesis of amino acids
    CL1_1205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1205
   00030 Pentose phosphate pathway
    CL1_1205
   00051 Fructose and mannose metabolism
    CL1_1205
  Energy metabolism
   00680 Methane metabolism
    CL1_1205
Enzymes [BR:thm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CL1_1205
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CL1_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167235..1168362
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITLSVIKADIGGWPGHSRVHPQLVETAEEVLSKAVEEGTIIDFYVATCGDDLQL
IMTHRKGVDSPDVHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPVVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPNMHMGFRFEVWDIKEHK
RVILSTPEELYDLLALIGAKSRYVIKRVFPKEGHKIAKDEPVAVVSTEKLFEIAGEYIGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEIAEYIRRHGPFEPHRLPMEDMEYTTL
PGVLERLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagagaagataaccctaagcgtcatcaaggccgacatcggcggctggccc
ggacactccagggtgcaccctcagctcgtcgagacggccgaggaagtcctctcaaaggct
gtcgaggagggaacgataatcgacttctacgtcgccacctgcggcgatgacctccagcta
ataatgacccacaggaagggtgtagacagccctgatgtccacggtcttgcctggaaggcc
ttcgaggaggccacaaaggttgccaaggagctcggcctctacggtgccggccaggatctt
ctcaaggacgccttcagtggtaacgtccgcggaatggggccgggagttgctgagatggag
ataacgctgagaaagagcgagccggtggttacattccacatggacaagaccgaacccggt
gccttcaacctcccgatattcagaatgttcgcggatcctttcaacaccgccggcctagtc
atcgacccgaacatgcacatgggcttccgcttcgaggtctgggacataaaggagcacaag
cgcgttatcctcagcactccggaggagctctacgacctcctcgccctcatcggcgccaag
agcaggtacgtcatcaagcgcgtcttcccgaaggagggccacaagatagccaaggacgag
ccggtcgctgttgtgagcaccgagaagctctttgaaatagccggtgagtacatagggaag
gacgacccggtcgccatcgtccgcgcccagagtggacttccagctctcggcgaggttctc
gagccattcgccttcccgcacctcgtcagcgggtggatgaggggttcccacaacggaccg
ataatgcccgtcccgatgcaccaggccaacccgacgaggttcgacggcccgccaagagtt
gttgccctcggctggcagataagccctgaaggaaagctcgtcggtccggttgatctgttc
gacgacccggcctttgactacgcaaggcagaaggcccttgagattgctgaatacatacgc
agacacgggcccttcgagccccacaggctcccgatggaggacatggagtacaccaccctt
ccgggcgtcctggagagactcgaagagcgctttgaggacatagagtga

DBGET integrated database retrieval system