KEGG   Thermococcus sp. CL1: CL1_1206Help
Entry
CL1_1206          CDS       T02169                                 

Definition
aldehyde: ferredoxin oxidoreductase 2
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CL1_1206
   01230 Biosynthesis of amino acids
    CL1_1206
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1206
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     CL1_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168523..1170481
Genome map
AA seq 652 aa AA seqDB search
MKFTVLRLKLDERKVESEEVDRDGIYGVIDYGIELHESLETHSLDPYDPRNVTVMGMGPF
SGSTLPGAHRLMFFFRSPLYGTLFPSAMGGAAYAFKNVGVDFVTFEGKAEKPVVVLLYND
GENVHVELHEIELEKVIEIWRGYKGEEGVYALTQYLIETFGDKFDFEYRIAVVGPASLNT
NYGAIFSQALRKGERLVGSEDWAARGGSGSVLLRAHNVVGIIFGGKPRKRPFPGEDIGNF
RTAKGIVEGVHKKPYNEIIAEKTTKYRFNPKLNTGGTFGGNYPAEGDFVPILNWQMPYIP
KEERIRIHENIMKHYWEPFNEEAIKPKNWTTCGEPCPVVCKKYRRGHHVEYEPYEANGPL
SGSISLRASDISVHAVDAMGFDAIEFGGTAAWVLELVHRGLLKPEEVGISGKPEFTKEAL
IERPVEASEVNAKLVAELAHRVAFAENEIARVIGLGKRKASVILDEKFKDRLKYGESFKD
YAVFTPLGENGEMTPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELASKIIASALWEF
WYDNVGWCRFHRGWMKPVLKALFMEAYGENVDMEEHARKQLKRLIEYARKAGYRPVFWDS
MRVIDLVAAGSEEFGNERWAEKFRIDKVGTAKEYLERVLDAYSEALGVEWRL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacagttctcaggctcaagctggacgagaggaaagttgagagtgaggaagtg
gatagagacgggatctacggcgtcatagactacggcatagagctccacgagagccttgaa
acgcactcccttgatccttatgatcccagaaacgtcacggtaatgggaatggggccgttc
tcgggctcaaccctgcccggagcgcacaggctaatgttcttcttccgctcgccgctctac
ggcacgctcttcccctctgcaatgggaggtgccgcttacgccttcaagaacgtcggcgtt
gatttcgtaacctttgagggcaaggccgagaagcccgttgtggtgctcctctacaacgac
ggtgagaacgttcacgttgagctccacgagattgaactcgaaaaggtcatagagatatgg
aggggctacaagggcgaagagggggtttatgccctcacccagtacctcatcgagaccttt
ggcgataagtttgacttcgagtacagaatagcggtcgttggaccggcctcgctgaacacc
aactacggcgctatattctcccaggccctcaggaagggagaacgtctggtcggcagtgaa
gactgggccgcgagaggaggctctggaagcgttctcctccgcgctcacaacgtcgttgga
ataatcttcggcgggaagccgaggaagaggcccttcccgggtgaagacatcggcaacttc
agaacggccaagggcatagtggaaggcgtccacaagaagccttacaacgagattatagct
gaaaagaccaccaagtaccgcttcaaccccaagctcaacactggcggaaccttcggcggc
aactaccctgccgagggcgacttcgtacccatactcaactggcagatgccgtacataccg
aaggaggagcgcattaggatacacgagaacataatgaagcactactgggagcccttcaac
gaagaggcgataaagcccaagaactggacgacctgcggcgagccgtgtcccgtcgtctgt
aagaagtacaggcgcggacaccacgtcgagtacgagccttacgaggccaacgggcccctc
agcgggagcatctccctgagggcaagcgacataagcgtccacgccgtcgatgcgatgggc
ttcgacgcgatagagttcggcggaaccgccgcctgggtccttgagctcgtccaccgcggt
ctgctcaagccggaggaagttggtataagcggaaagccggagttcacgaaggaggcttta
atcgagcgcccggtcgaggcgagcgaggtcaacgcaaagcttgtggctgaattggcccac
cgcgtcgccttcgccgagaacgagattgccagggtaatcggtctcggcaagaggaaggcg
agcgttatcctcgacgagaagttcaaggacaggctcaagtacggcgagagcttcaaggac
tacgcggtcttcactcccctcggcgagaacggcgagatgacaccgacgatgtactgggcc
atcggcaactacataccgctcccgattcaaggaagatactggaccttctatcagttcggc
gtcttcctcgagcccgaggagctggcgagcaagataatagcgagcgccctctgggagttc
tggtacgacaacgtcggctggtgccgcttccacaggggctggatgaagcccgtccttaag
gcgctcttcatggaggcctacggtgagaacgtggacatggaggagcacgcgaggaagcag
ctcaagaggctcatcgagtacgcgaggaaggccggctacaggcctgtcttctgggactcg
atgcgcgttatagacctcgtggcagcgggaagcgaggagttcggaaatgaaagatgggcc
gagaagttcaggattgacaaggtcggcacggcaaaggagtatctcgaaagggttcttgat
gcctacagcgaagcgctcggcgttgagtggaggctctga

DBGET integrated database retrieval system