KEGG   Thermococcus cleftensis: CL1_1233Help
Entry
CL1_1233          CDS       T02169                                 

Definition
(GenBank) hypothetical protein containing ribokinase-like domain 2
  KO
K21056  
alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
thm  Thermococcus cleftensis
Brite
Enzymes [BR:thm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     CL1_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1192746..1193636
Genome map
AA seq 296 aa AA seqDB search
MARFDVVGIGNLNYDIIMLLDRFPEFHEKVNAREAFFGLGGAAANTISWLAHFGLKTGYI
GAVGRDEIGNAHLEYFRSIGVDTGGIRVVDAPSGVAIAMIRGEDKRIVKYPGANLMKGVD
FDYLARTRHVHLSSNPPETIEQVVAFASENGITVSLDIGEAALPKEIEEKVDYLMMNEDE
YRRKFGSLDLSLSSARNLVVTLNGGGALVRDESGRISEVRGLSAEVVDSTGAGDSFDAGV
IYGVLSGWSLEDAARLGMLLAYLTVQKVGARSAIVPLEEVIRRAGEVGLELPFNGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtttgatgtggtgggaatagggaacctgaactacgacataataatgctcctc
gacagatttccggagttccacgagaaggtgaacgcgagggaggctttcttcggtctaggc
ggggcggcggcgaacactataagctggctcgctcacttcggccttaaaaccggctacatc
ggtgcggttggaagggacgagataggaaacgcccacctggagtacttcaggagcattgga
gtggacaccggcggaatcagggtcgtcgatgctccctctggcgttgcgatagcgatgata
cgtggggaggacaagaggatagtgaagtaccccggcgccaacctgatgaagggtgtggac
ttcgattacctggccaggacgaggcacgttcacctctcctccaacccgccggagacgata
gaacaggtcgtggcattcgcgagcgagaatgggataaccgtttcgctcgacataggtgaa
gcggccctgccaaaggagatcgaggagaaagttgattacctgatgatgaacgaggacgag
tacaggagaaagttcggctccctcgacctctcgctctcctcggccagaaacctcgtggtg
accctcaacgggggcggtgccctggtgagggacgaaagcgggaggatcagcgaggtcagg
ggtctaagcgccgaggtcgtggattcaaccggtgcgggggattccttcgacgcgggtgtt
atctacggcgtcctcagtgggtggagcctcgaggacgcggcccggctgggaatgctcctg
gcttacctcaccgttcagaaggttggggcaaggagcgcgatagtgccccttgaagaggtc
atcagaagggccggggaggttggtcttgaacttccgttcaacgggcggtga

DBGET integrated database retrieval system