KEGG   Thermococcus sp. CL1: CL1_1243Help
Entry
CL1_1243          CDS       T02169                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CL1_1243
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1243
   00020 Citrate cycle (TCA cycle)
    CL1_1243
   00620 Pyruvate metabolism
    CL1_1243
   00640 Propanoate metabolism
    CL1_1243
   00650 Butanoate metabolism
    CL1_1243
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CL1_1243
   00680 Methane metabolism
    CL1_1243
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CL1_1243
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CL1_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1201722..1202717)
Genome map
AA seq 331 aa AA seqDB search
MAVRKPPVTTREYWAPGHAACAGCGCATALRLATKAFSEAMEEKYGDPNAFAIAQATGCM
EVVSAVFPYTAWKAPWVHVAFENAAAVASGVEAAWKKLGRKGKILAIGGDGGTADIGMQA
LSGMLERWHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKLSIGEDKPKKWVALI
AAAHQIPYVATASIGNPFDFVKKMKKAAKVDGPAFVQVQCTCPTGWKSPLEKGVEIARLA
IETGVWPLFEIENGDFHNIKIQSPGGGAKVKREGGRVVAIEFKKPIEEYLKLQGRFKHLF
KQPEAIDVMREQIKAMWKVLGVDVTLPKPEE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaggaagccccccgttaccactcgcgagtactgggcacccggtcacgccgcc
tgtgccggctgtgggtgtgccaccgctctgaggctcgccaccaaggccttcagcgaggcc
atggaggagaagtatggtgacccgaacgccttcgccatagcccaggccacgggctgtatg
gaggtcgtttcagcagtcttcccctacaccgcctggaaggccccgtgggttcacgtggcc
tttgagaacgctgcagcggttgcgagcggtgtcgaagcagcgtggaagaagctcggaagg
aagggcaagatactggctataggcggtgacggtggtaccgccgacatcggtatgcaggcc
ctcagcggtatgcttgagcgctggcacaacgtggtttacctcatgtacgacaacgaggcc
tacatgaacactggaatccagcgctctagctcaaccccctacggtgcctggaccaccacc
agcccgccgggcaagctctccatcggtgaggacaagcccaagaagtgggtcgcgcttata
gctgccgcccaccagatcccgtacgttgcaaccgccagcataggcaacccctttgacttc
gtcaagaagatgaagaaggccgccaaggtcgatggcccggcattcgtccaggttcagtgt
acttgcccaaccggctggaagagcccgctcgagaagggcgtcgagatcgcccgcctggcc
atagagacaggcgtctggccgctcttcgagatcgagaacggcgacttccacaacatcaag
atacagagccccggagggggagcgaaggtcaagcgcgagggcggtcgcgtagtcgccata
gagttcaagaagcccatcgaggagtaccttaaactgcagggcaggttcaagcacctcttc
aagcagccggaagccatcgatgttatgcgcgagcagatcaaggccatgtggaaggttctc
ggcgtcgacgtcaccctcccgaagccggaggagtga

DBGET integrated database retrieval system