KEGG   Thermococcus sp. CL1: CL1_1245Help
Entry
CL1_1245          CDS       T02169                                 

Definition
pyruvate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:thm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:thm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:thm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:thm00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:thm00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:thm00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1203924..1204241)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIATIPGSSVINKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDEENYPVFDFDYCKGCGICANECPTDAIIMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtccgtttaaggccgacatcgagagggttcagaaggagtatagcgaaaag
atgaccccgggagcgatagccaccattccggggagcagcgtgataaacaagaccggttcc
tggagagtttttatgcccgagttcaacagggacaagtgcgtccgctgctacctctgctac
atctactgcccggagccggccatctacctcgacgaggagaactatccggtctttgacttc
gactactgcaagggctgtgggatatgtgccaacgagtgcccgaccgatgccataataatg
gttagggagaccaagtga

DBGET integrated database retrieval system