KEGG   Thermococcus cleftensis: CL1_1246Help
Entry
CL1_1246          CDS       T02169                                 

Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase subunit beta
  KO
K00187  2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
thm  Thermococcus cleftensis
Pathway
thm00280  Valine, leucine and isoleucine degradation
thm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CL1_1246
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     CL1_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFL95445
UniProt: I3ZUR1
Position
complement(1204303..1205238)
Genome map
AA seq 311 aa AA seqDB search
MEIPENVKKRLSIPAEEHFYAGHTACQGCGASLGLRYVLKAYGKKTIFAIPACCSTIIAG
PWPYSALNANLFHTAFETTGAVIGGIEAALKAKGYKVKGEDGIMVVGWAGDGGTADIGLQ
ALSGFLERGHDAVYIMYDNEAYMNTGIQRSGSTPYGAWTTNTPGGKKHFLEKRHKKKVID
IVIAHEIPYAATASVAYPEDFIRKLKKAQKIPGPSFIQLFAPCPTGWRSPTDKSIELARL
AVQTAYFPLFEYENGKYKINMPSTKKEPKPIEEFLKYQGRFKYMTKEDIEILQQWVLHEW
EKLKKLAEVFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagattcccgagaacgttaagaagaggttgagcataccggcggaagagcacttctac
gccggccacacggcctgccagggctgtggcgcttccctcggactccgctatgtcctcaaa
gcttacgggaagaagacgatattcgccattcctgcgtgctgttcaaccatcatcgctggc
ccctggccgtacagcgcgctcaacgccaatctgttccacacggcctttgaaaccaccggt
gccgttataggtggtattgaggcggccctcaaggccaagggatacaaggtcaagggcgag
gacggaataatggtcgtcggctgggccggcgacggaggaaccgccgacataggactccaa
gccctgagcggcttcctcgagaggggtcacgatgcggtttacataatgtacgacaacgag
gcctacatgaacaccggaatccagaggtccggttcgaccccgtacggtgcctggaccacc
aacacccctggcggaaagaagcacttcctcgagaagaggcacaagaagaaggtcatcgac
atagtcatagcccacgagataccctacgccgccaccgcaagcgtcgcctatccggaggac
ttcataaggaagctcaagaaggcccagaagatccctggaccgagcttcatccagctcttc
gcgccgtgcccgaccggctggcgctcaccgaccgacaagagcatcgagctcgcgaggctc
gcggttcagacggcctacttcccgctcttcgagtacgagaacggaaagtacaagatcaac
atgccgagcaccaagaaggagccgaaaccgatagaggagttcctcaagtaccagggcagg
tttaagtacatgaccaaggaggacattgagatcctccagcagtgggtcctccacgagtgg
gagaagctcaagaagctcgccgaggtcttcggctga

DBGET integrated database retrieval system