KEGG   Thermococcus sp. CL1: CL1_1247Help
Entry
CL1_1247          CDS       T02169                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
thm  Thermococcus sp. CL1
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:thm00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205244..1206431)
Genome map
AA seq 395 aa AA seqDB search
MEYKPIRKVVSGNYAAAYAVKHARVEVVAAYPITPQTSIIEKIAEFLANGEIEGLEYVPV
ESEHSAMAACIGASATGARAFTATSAQGLALMHEMLHWAAGARLPIVMVDVNRAMAPPWS
VWDDQTDSLAQRDTGWLQFYAENNQEVYDGVLMAFKIAETVNLPAMVVESAFILSHTYDV
VEMIPQELVDEFLPPRKPLYTLTDFDNPVAVGALGGPNDYYEFRYKIAKAMEDAKKVIHE
VGKEFGERFGRDYSQMIELYRTDDADFVFMGMGSLMGTVKQAVDVLRDEGYKVGAAKVRW
FRPFPKEELYELAKSVEGIAVLDRNFSFGQEGILFNEAKGALYNTNAKPLMKNYIVGLGG
RDFTVSDVRKIAENMKAIIEKGELDVEVDWYHLKR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaagcccattagaaaggtcgtgagcggcaactacgcggccgcttacgccgtt
aaacacgcccgcgttgaggtcgtcgcggcttaccccatcaccccccagaccagcatcatc
gagaagatagccgagttcctcgccaacggagagatagaggggcttgagtacgtaccggtc
gagagcgagcactcagccatggccgcctgtataggagcgagcgcgaccggcgccagggct
ttcaccgccacctccgcccagggtctcgctctcatgcacgagatgctacactgggcggct
ggagcgaggctgccgatagtcatggtcgatgtgaaccgtgccatggctcccccctggagc
gtctgggacgaccagaccgacagtttggcgcagagggacaccggctggctccagttctac
gcggagaacaaccaagaggtctacgacggtgtgctgatggcattcaagatagccgagacc
gtgaacctccccgcgatggttgtcgagagtgccttcatactgagccacacctacgacgtt
gtcgagatgatcccacaggagctggtcgatgagttccttccgccaaggaagccgctctac
acgctcaccgacttcgacaaccccgttgctgtaggtgcccttggtggccccaacgactac
tacgagttccgctacaagatagccaaggctatggaagatgccaagaaggtcattcacgag
gttggaaaagagttcggcgagcgctttggaagggactacagccagatgatagagctatac
aggactgacgacgcagacttcgtcttcatgggtatgggttcactcatgggaaccgtcaag
caggcggtcgatgttctccgcgatgagggctacaaggtcggcgccgcgaaggtccgctgg
ttcaggcccttcccgaaggaggagctttacgagctggcaaagagcgttgaaggcatagcc
gtcctcgacaggaacttctccttcggccaggagggcatactcttcaacgaggccaaggga
gcgctctacaacaccaatgcaaagccgctcatgaagaactacatagtcggcctcggagga
agggacttcaccgtcagcgacgtcaggaagatagccgagaacatgaaggccatcatcgag
aagggagagctagatgtagaggtggactggtaccaccttaagaggtga

DBGET integrated database retrieval system