KEGG   Thermococcus sp. CL1: CL1_1249Help
Entry
CL1_1249          CDS       T02169                                 

Definition
(RefSeq) pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CL1_1249
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1249
   00020 Citrate cycle (TCA cycle)
    CL1_1249
   00620 Pyruvate metabolism
    CL1_1249
   00640 Propanoate metabolism
    CL1_1249
   00650 Butanoate metabolism
    CL1_1249
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CL1_1249
   00680 Methane metabolism
    CL1_1249
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CL1_1249
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CL1_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1206803..1207360)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDERPIRI
KTQIYEPDIVVVLDPSLLDTVDVTAGLKDDGIVIVNTEKSKEEVLEKLKKKPAKLALVDA
TTIALDVLGLPITNTAILGAVAKATGVVTLEHVQKAIQDVFSGSLGEKNAKAAEEAFNKT
TVYEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagattcgttttcacggtaggggtggacagggtgccgttaccgccgccaacata
ctagcctcagccgctttccttgagggcaagtacgtccaggcgttcccgttcttcggtgtc
gagaggcgtggagcgccggttacagcgttcaccaggatcgacgagaggccgataaggata
aagacccagatatacgagcccgacatagtggtcgtcctcgacccgagccttctcgacacc
gttgacgtcaccgcaggtctcaaggacgacggaatcgtcatcgtcaacacagagaagagc
aaggaagaggttctcgagaagctcaagaagaagccggccaagctggccctcgtcgatgcc
accaccatagccctcgacgtccttggccttccaattaccaacaccgcaatcctcggtgcg
gtcgcaaaggccaccggcgtcgtcaccctcgagcacgtccagaaggccattcaggacgtc
ttctccggatccctcggcgagaagaacgccaaggccgcagaggaagcattcaacaagact
accgtttacgagctctaa

DBGET integrated database retrieval system