KEGG   Thermococcus sp. CL1: CL1_1249Help
Entry
CL1_1249          CDS       T02169                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CL1_1249
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1249
   00020 Citrate cycle (TCA cycle)
    CL1_1249
   00620 Pyruvate metabolism
    CL1_1249
   00640 Propanoate metabolism
    CL1_1249
   00650 Butanoate metabolism
    CL1_1249
  Energy metabolism
   00680 Methane metabolism
    CL1_1249
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CL1_1249
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CL1_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1206803..1207360)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDERPIRI
KTQIYEPDIVVVLDPSLLDTVDVTAGLKDDGIVIVNTEKSKEEVLEKLKKKPAKLALVDA
TTIALDVLGLPITNTAILGAVAKATGVVTLEHVQKAIQDVFSGSLGEKNAKAAEEAFNKT
TVYEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagattcgttttcacggtaggggtggacagggtgccgttaccgccgccaacata
ctagcctcagccgctttccttgagggcaagtacgtccaggcgttcccgttcttcggtgtc
gagaggcgtggagcgccggttacagcgttcaccaggatcgacgagaggccgataaggata
aagacccagatatacgagcccgacatagtggtcgtcctcgacccgagccttctcgacacc
gttgacgtcaccgcaggtctcaaggacgacggaatcgtcatcgtcaacacagagaagagc
aaggaagaggttctcgagaagctcaagaagaagccggccaagctggccctcgtcgatgcc
accaccatagccctcgacgtccttggccttccaattaccaacaccgcaatcctcggtgcg
gtcgcaaaggccaccggcgtcgtcaccctcgagcacgtccagaaggccattcaggacgtc
ttctccggatccctcggcgagaagaacgccaaggccgcagaggaagcattcaacaagact
accgtttacgagctctaa

DBGET integrated database retrieval system