KEGG   Thermococcus cleftensis: CL1_1249Help
Entry
CL1_1249          CDS       T02169                                 

Definition
(GenBank) pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
thm  Thermococcus cleftensis
Pathway
thm00010  Glycolysis / Gluconeogenesis
thm00020  Citrate cycle (TCA cycle)
thm00620  Pyruvate metabolism
thm00640  Propanoate metabolism
thm00650  Butanoate metabolism
thm00680  Methane metabolism
thm00720  Carbon fixation pathways in prokaryotes
thm01100  Metabolic pathways
thm01120  Microbial metabolism in diverse environments
thm01130  Biosynthesis of antibiotics
thm01200  Carbon metabolism
Module
thm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL1_1249
   00020 Citrate cycle (TCA cycle)
    CL1_1249
   00620 Pyruvate metabolism
    CL1_1249
   00640 Propanoate metabolism
    CL1_1249
   00650 Butanoate metabolism
    CL1_1249
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CL1_1249
   00680 Methane metabolism
    CL1_1249
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CL1_1249
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CL1_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFL95448
UniProt: I3ZUR4
Position
complement(1206803..1207360)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDERPIRI
KTQIYEPDIVVVLDPSLLDTVDVTAGLKDDGIVIVNTEKSKEEVLEKLKKKPAKLALVDA
TTIALDVLGLPITNTAILGAVAKATGVVTLEHVQKAIQDVFSGSLGEKNAKAAEEAFNKT
TVYEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagattcgttttcacggtaggggtggacagggtgccgttaccgccgccaacata
ctagcctcagccgctttccttgagggcaagtacgtccaggcgttcccgttcttcggtgtc
gagaggcgtggagcgccggttacagcgttcaccaggatcgacgagaggccgataaggata
aagacccagatatacgagcccgacatagtggtcgtcctcgacccgagccttctcgacacc
gttgacgtcaccgcaggtctcaaggacgacggaatcgtcatcgtcaacacagagaagagc
aaggaagaggttctcgagaagctcaagaagaagccggccaagctggccctcgtcgatgcc
accaccatagccctcgacgtccttggccttccaattaccaacaccgcaatcctcggtgcg
gtcgcaaaggccaccggcgtcgtcaccctcgagcacgtccagaaggccattcaggacgtc
ttctccggatccctcggcgagaagaacgccaaggccgcagaggaagcattcaacaagact
accgtttacgagctctaa

DBGET integrated database retrieval system