KEGG   Thermococcus sp. CL1: CL1_1302Help
Entry
CL1_1302          CDS       T02169                                 

Definition
(RefSeq) threonine synthase 2
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thm  Thermococcus sp. CL1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CL1_1302
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CL1_1302
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CL1_1302
Enzymes [BR:thm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CL1_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1255006..1256136)
Genome map
AA seq 376 aa AA seqDB search
MKLVCPICGKTYDEPVQRCECGEPVEFEPFTGEPYIGKTVWERFWDFWPVEPELELSLGE
GDTPLVRSKLGEEFGIRLYLKNETVNPTWSFKDRGTFLAMGYALKAGYRAVGTVSTGNMA
ASVSAYASRFGLEAKILVSESAGDEKLKAVSVYGGDVIRVRGDYGKLYFESLKLGERLGV
YFINSDNPFRIEGYKGIAFEIAEELTPDYVLIPTSSGGLFRGIAKGFIELHESGLIEELP
KLIAVQAEGCSPICRAFKGGKERIERFDNPKTIAKAIANPYPPSGNAVLKLLREFGWGCV
SVSDGEILDAQRKLAREGLFVQPASATGVAALRKLDLPEGAKVVSILTGSGLRTLRNAPA
GEVRECPLERLEDCLR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcgtctgcccgatctgcgggaaaacctacgacgaaccggttcagaggtgcgag
tgcggcgaacccgtggagttcgagcccttcacaggggagccttacatcggaaagaccgtt
tgggaacgcttctgggatttctggccggtcgaaccagagcttgagctttccctcggcgag
ggcgacacgccgctagtgaggtcgaagctcggagaggagtttggaataaggctctacctc
aagaacgagacggtgaacccgacctggagcttcaaggacagggggacgtttttagcaatg
ggctacgccctcaaggccggttacagggcggtcggaacggtatcaaccggcaacatggcg
gcgagcgtctcggcctacgcctcccgctttggattggaggcgaagatactcgtctcagag
agcgcgggcgacgagaagctcaaagcagtttccgtctacggcggggacgtcatcagggtt
cgcggtgactatggaaagctctacttcgagagcctgaagctgggggaaaggctgggcgtt
tatttcatcaactccgacaaccccttcaggatagagggctacaaaggcatcgccttcgag
atagcggaagagctgacaccggactacgttttgattccaacgagctcggggggccttttc
cgaggaatagcaaagggcttcattgagctacacgagagcgggctcattgaagaactcccg
aagctaatcgccgttcaggccgagggctgctcgccaatatgccgggcattcaagggaggg
aaagagagaatagagcgctttgacaacccgaagacgatagccaaggccatagccaacccc
tacccgccgagcgggaacgcggttctgaagctcctccgggagttcggctggggctgcgtt
tcggtgagcgacggggaaatcctcgatgcacagagaaagctcgcccgcgagggcctcttc
gtccagcccgcgagcgccacaggggtggccgctttgagaaagctcgacctgccggagggg
gcaaaggtcgtctccattctcaccggttcgggtttgagaactctgagaaacgcgccggcc
ggggaggtaagggaatgccccctcgaaagacttgaggactgtctgaggtga

DBGET integrated database retrieval system