KEGG   Thermococcus cleftensis: CL1_1348Help
Entry
CL1_1348          CDS       T02169                                 

Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thm  Thermococcus cleftensis
Pathway
thm00030  Pentose phosphate pathway
thm01100  Metabolic pathways
thm01120  Microbial metabolism in diverse environments
thm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CL1_1348
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CL1_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AFL95547
UniProt: I3ZV13
Position
1306915..1308732
Genome map
AA seq 605 aa AA seqDB search
MFAYWGKILRVNLTDGTIKEETFDEKFAKKWLGTRGFGIYYLLKEMDPTVDPFSPENKMI
FATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGASDHPV
YLYINDESVEIRDASHLWGKTSTETEEALKEEIGDKRIRVALIGPAGENLVRFAAVMNDE
HRAAGRGGVGAVMGSKKLKAIVVRGHKRVEVADRAKFTSVVKEKTDKLRNDPTAGGGLPK
YGTAVLVNIINQNGLYPTRNFQYSQFEYAEEQSGEAMAAKYLIRNKPCYACPIGCGRVNK
LPTTGVTEGPEYESIWALGAHNGINDLASIIEANHWADEYGMDTISLGGTLATAMELYEK
GLLKQEDLGEEAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGGYRLAEMYNGTEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDIGDEKVKMVI
LFQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDLSTEEYLKIGERIWNAERLFNL
RAGLDPLKEDTLPKRLLEEPVRNGPNKGHVVRLHLMLPKYYKFRGWTEDGKITEEKMKEL
GIDEF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgtactggggtaagattttgagggtgaacctgacagatggaaccatcaaggaa
gagaccttcgacgagaagttcgccaagaagtggctcgggacgagggggttcggcatctac
tacctcctcaaggagatggacccgaccgtggatcccttcagcccggagaacaagatgatt
ttcgccaccgggcctctgaccggaaccaccgctcccaccggtgggaggtacatggtgata
accaagagcccgctgacgggctatattgcaatggcgaactcgggtggattctttggtgcg
gagctcaagttcgcgggctgggacgccatcatagtggaaggagcctccgaccacccggtt
tacctctacataaacgacgagagcgttgagattcgcgacgccagccacctctggggcaag
acctccaccgagaccgaggaggccctcaaggaggaaatcggagacaagagaatccgcgtt
gcactcataggtccggcaggtgagaacctcgtaaggtttgcggccgtaatgaacgatgag
cacagggccgccggtaggggtggcgttggtgcagtgatgggaagcaagaagctgaaggcg
atagtcgtccgcggacacaagcgcgttgaggttgccgacagggcaaagttcacgagcgtc
gtcaaggagaagaccgacaagctcaggaacgacccgaccgccggcggtggactgccgaag
tatggaacggccgttttagttaacatcatcaaccagaacggcctctacccgacgagaaac
ttccagtacagccagttcgagtacgcagaggagcagagcggtgaggccatggcggccaag
tacctgataaggaacaagccgtgctacgcctgtccgataggctgtggaagggtcaacaag
ctcccgaccacgggggtcacggaggggccggagtacgagagcatatgggcgctcggagcg
cacaacggaataaacgacctcgcgagcataatcgaggccaaccactgggccgacgagtac
ggtatggacaccataagcctcggcggaaccctcgcgactgcgatggaactctacgagaag
ggcctgctcaagcaggaggacctcggagaggaggctccgcccttcagatggggcaacacg
gaagttctgcactactacatcgagaagatagccaagagagaaggcttcggtgacaagctg
gccgaaggtggctaccgcctggccgagatgtacaacggtacagagtacttcatgggcgtc
aagaagcaggagcttcctgcatatgacccgaggggagcagagggacacggcctcggctac
gccaccaacaaccgcggtggctgccacatcaagcagtacatgataagtcccgagatcctc
ggctacccctacaagatggacccgcacgacatcggtgacgagaaggtcaagatggtcata
ctcttccaggacctaactgccctcattgacgccgctggactgtgtgtcttcacgaccttc
ggtctcggagcggacgactaccgcgacatgctgaacgcggcccttggctgggacctctcg
accgaggagtacctcaagataggcgagcgcatctggaacgccgagaggctcttcaacctc
agggccggcctcgacccgctcaaggaggacaccctacccaagagactgcttgaggagccc
gtcaggaacgggccgaacaaggggcacgtcgtcaggctgcacctgatgcttccgaagtac
tacaagttccgcggctggaccgaggacggaaagataaccgaggagaagatgaaggagctc
ggtatcgacgagttctga

DBGET integrated database retrieval system