KEGG   Thermococcus sp. CL1: CL1_1527Help
Entry
CL1_1527          CDS       T02169                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
thm  Thermococcus sp. CL1
Brite
Enzymes [BR:thm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CL1_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467472..1468107
Genome map
AA seq 211 aa AA seqDB search
MWERTVESLSSEGLIRSDAVRRAFLKYPRYLFVEKRHQKYAHLDEPLPIPAGQTVSAPHM
VAIMLELADLKPGMNVLEIGTGSGWNAALISELVGTDVYTIERIPELVEFARQNLERAGV
KNVHVFLGDGTLGFPPKAPYDRIIVTAGAPEVPKPLLEQLKPGGRLIIPVGSHHLWQELY
VVEKTDDGRIRKRRWGSVVFVPLIGAHGWRG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggagaggaccgttgagagcctctccagtgaggggttgatacggagcgatgccgtt
aggagggcttttctaaagtacccccgctacctctttgtcgagaagaggcatcaaaagtat
gcccatctcgacgagcctctgccgatcccagccgggcaaacagtgagtgccccacatatg
gttgcaataatgcttgagctggcagacttaaaaccgggaatgaacgtcctcgagatagga
actggcagtggctggaacgcggccctaatctcggaactcgtggggaccgacgtctatacc
atcgagaggattcccgagttggttgagttcgcgaggcagaaccttgaaagggcgggggta
aagaacgtccacgttttccttggtgacgggacgctcggctttcctccgaaagccccttac
gacaggataattgtaaccgccggagcgcccgaggttccaaagcccctcctcgagcagctc
aaacctggggggcggctgataatacctgtgggaagccaccacctgtggcaggagctgtac
gttgtggagaagactgatgacggaaggataagaaaaaggcgctggggcagcgttgtcttc
gtgcccctcataggggcgcacggctggcgggggtag

DBGET integrated database retrieval system